KEGG   Homo sapiens (human): 2960
Entry
2960              CDS       T01001                                 
Symbol
GTF2E1, FE, TF2E1, TFIIE-A
Name
(RefSeq) general transcription factor IIE subunit 1
  KO
K03136  transcription initiation factor TFIIE subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    2960 (GTF2E1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    2960 (GTF2E1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2960 (GTF2E1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     2960 (GTF2E1)
 Prokaryotic type
  Archaeal type
    TFE
     2960 (GTF2E1)
SSDB
Motif
Pfam: TFIIE_alpha TFIIE-A_C TF_Zn_Ribbon OrfB_Zn_ribbon Rad50_zn_hook Elf1
Other DBs
NCBI-GeneID: 2960
NCBI-ProteinID: NP_005504
OMIM: 189962
HGNC: 4650
Ensembl: ENSG00000153767
Pharos: P29083(Tbio)
UniProt: P29083
Structure
LinkDB
Position
3:120742744..120783069
AA seq 439 aa
MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLR
SVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERD
STNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDARTLLARF
NEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAGAASLAGGHHREAWA
TKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYGSEDMKEGGI
DMDAFQEREEGHAGPDDNEEVMRALLIHEKKTSSAMAGSVGAAAPVTAANGSDSESETSE
SDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAGRPFSYSEVSQRPELVAQMTP
EEKEAYIAMGQRMFEDLFE
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggcagacccagatgtcctcactgaagttccagcagcattgaagcggttagccaagtat
gtgatccggggattttatggcattgagcatgccttggccttggacatcttgatcaggaac
tcctgtgtgaaagaggaggatatgctggagctgctcaagtttgatcggaagcaacttcga
tcagttttgaataatttaaagggagacaagtttatcaaatgcagaatgagggtagagact
gctgcagacgggaaaaccactcgccataactactacttcatcaattatcgtactcttgtt
aatgtggtaaaatataaactggaccacatgagaagaagaattgagaccgatgagagagat
tcgaccaaccgggcttccttcaaatgtcctgtctgtagtagtactttcacagacttagaa
gctaatcagctctttgatcctatgacaggaactttccgctgtactttttgccatacagag
gtagaagaggatgaatcagcaatgcccaaaaaagatgcacgcacacttttggcaaggttt
aatgaacaaattgagcccatttatgcattgcttcgggagacagaggatgtgaacttggcc
tatgaaatacttgagccagaacccacagaaatcccagccctgaaacagagcaaggaccat
gcagcaactactgctggagctgctagcctagcaggtgggcaccaccgggaagcatgggcc
accaaaggtccttcctatgaagacttatacactcagaatgttgtcattaacatggatgac
caagaagatcttcatcgagcctcactggaagggaaatctgccaaagagaggcctatttgg
ttgagagaaagcactgtccaaggggcatatggttctgaagatatgaaagaagggggcata
gatatggacgcatttcaggagcgtgaggaaggccatgctgggcctgatgacaacgaagag
gtcatgcgagcactgctcattcacgagaaaaagacttcctctgccatggctggttcagtg
ggggcagctgctccagtgaccgctgccaatggcagtgactcagaaagcgagaccagtgag
tcagatgatgattctccaccccgtccggcagctgtggctgtgcataaacgagaagaggat
gaagaggaagatgacgagtttgaagaagtagcagatgaccccattgtcatggtggctggc
cgtccgttctcctacagtgaagtgagccaacggccagagctagtggcccagatgacacca
gaagaaaaggaagcatatatagcaatgggacaacgcatgtttgaggacctctttgagtga

KEGG   Homo sapiens (human): 2961
Entry
2961              CDS       T01001                                 
Symbol
GTF2E2, FE, TF2E2, TFIIE-B, TTD6
Name
(RefSeq) general transcription factor IIE subunit 2
  KO
K03137  transcription initiation factor TFIIE subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05203  Viral carcinogenesis
Disease
H00866  Trichothiodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    2961 (GTF2E2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    2961 (GTF2E2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2961 (GTF2E2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     2961 (GTF2E2)
SSDB
Motif
Pfam: TFIIE_beta TFA2_Winged_2
Other DBs
NCBI-GeneID: 2961
NCBI-ProteinID: NP_002086
OMIM: 189964
HGNC: 4651
Ensembl: ENSG00000197265
Pharos: P29084(Tbio)
UniProt: P29084
Structure
LinkDB
Position
8:complement(30578318..30658236)
AA seq 291 aa
MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNG
SFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLM
TEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQK
AVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQ
GISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
NT seq 876 nt   +upstreamnt  +downstreamnt
atggatccaagcctgttgagagaaagggagctgttcaaaaaacgagctctttctactcct
gtagtagaaaaacgttcagcatcttctgagtcatcatcatcatcgtcaaagaagaagaaa
acaaaggtagaacatggaggatcgtcaggctctaaacaaaattctgatcatagcaatgga
tcatttaacttgaaagctttgtcaggaagctctggatataagtttggtgttcttgctaag
attgtgaattacatgaagacacggcatcagcgaggagatacgcatcctctaaccttagat
gaaattttggatgaaacacaacatttagatattggactcaagcagaaacaatggctaatg
actgaggctttagtcaacaatcccaaaattgaagtaatagatgggaagtatgctttcaag
cccaagtacaacgtgagagataagaaggccctacttaggctcttagatcagcatgaccag
cgaggattaggaggaattcttttagaagacatagaagaagcactgcccaattcccagaaa
gctgtcaaggctttgggggaccagatactatttgtaaatcgtcccgataagaagaaaata
cttttcttcaatgataagagctgtcagttttctgtggatgaagaatttcagaaactgtgg
aggagtgtcactgtagattccatggacgaggagaaaattgaagaatatctgaagcgacag
ggtatttcttccatgcaggaatctggaccaaagaaagtggcccctattcagagaaggaaa
aagcctgcttcacagaaaaagcgacgctttaagactcataacgaacacttggctggagtg
ctgaaggattactctgacattacttccagcaaatag

DBGET integrated database retrieval system