KEGG   Homo sapiens (human): 2962
Entry
2962              CDS       T01001                                 

Gene name
GTF2F1, BTF4, RAP74, TF2F1, TFIIF
Definition
(RefSeq) general transcription factor IIF subunit 1
  KO
K03138  transcription initiation factor TFIIF subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    2962 (GTF2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2962 (GTF2F1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     2962 (GTF2F1)
SSDB
Motif
Pfam: TFIIF_alpha
Other DBs
NCBI-GeneID: 2962
NCBI-ProteinID: NP_002087
OMIM: 189968
HGNC: 4652
Ensembl: ENSG00000125651
Vega: OTTHUMG00000168087
Pharos: P35269(Tbio)
UniProt: P35269
LinkDB
Structure
PDB: 

Position
19p13.3
AA seq 517 aa
MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEE
EMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTE
NTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQR
RLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPL
AKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKG
VDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSA
LFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAA
KRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTK
KTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggcggccctaggccctagcagccagaatgtcactgaatacgtcgttcgagttcctaag
aatacaaccaaaaaatataacatcatggcttttaatgcagccgacaaagtcaactttgct
acgtggaatcaggctcggctggagcgggacttgagcaacaagaaaatctaccaagaggag
gagatgcccgaatcgggcgcgggcagtgagttcaaccgcaagcttcgggaggaggctcgg
aggaagaagtacggcatcgtcctcaaggagttccggcccgaggaccagccctggctgctc
cgggtcaacggcaaatcaggcaggaagttcaagggcatcaagaagggaggcgtaacagag
aacacgtcctactacatcttcacccagtgccccgacggggccttcgaggccttccccgtg
cacaactggtacaatttcacaccgctggcccggcatcgcacgctcactgccgaggaggcc
gaggaggagtgggagaggaggaacaaggtgctgaaccacttcagcatcatgcagcagcgg
cggctcaaggatcaggaccaggacgaggatgaggaggagaaggagaaacgtggccgcagg
aaggcgagcgagctgcgcatccacgacctggaggacgacctggagatgtcgtccgatgcc
agtgatgccagtggtgaggaggggggcagagtccccaaggccaagaagaaggcgccgctg
gccaagggcggcaggaaaaagaagaagaagaagggttcagacgacgaggccttcgaggac
agcgatgatggggacttcgagggccaagaggtggactacatgtcagacggctccagtagc
tcccaagaagagcctgagagcaaggccaaggcgccgcagcaggaggaggggcccaagggt
gtcgatgagcagagcgacagtagtgaggagagtgaggaggagaagccgcctgaggaggac
aaggaggaggaggaggagaagaaggcacccaccccgcaggagaagaagcgcaggaaagac
agcagcgaggagtcggacagctcagaggagagcgacattgacagcgaggcctcctcagcc
ctcttcatggcgaagaagaagacgccacccaagagagagcggaagccgtcgggagggagc
tcaaggggcaacagccgcccaggcacgcccagcgcagagggtggcagcacctcctccacc
ctgcgggcggctgccagcaaactcgagcaagggaagcgggtgagcgagatgcctgcagcc
aagcggttgcggctggacacgggaccccagagcctgtctgggaagtcgacaccccagcca
ccatcaggcaagacaacacccaacagcggcgacgtgcaggtgactgaggatgccgtgcgc
cgctacctgacacggaagcccatgaccactaaggacctgctgaaaaagttccagaccaag
aagacagggctgagcagcgagcagacagtgaacgtgttggcccagatcctcaagcgactc
aaccccgagcgcaagatgatcaacgacaaaatgcacttctccctcaaggagtga

DBGET integrated database retrieval system