KEGG   Homo sapiens (human): 29896
Entry
29896             CDS       T01001                                 
Symbol
TRA2A, AWMS1, HSU53209
Name
(RefSeq) transformer 2 alpha homolog
  KO
K12897  transformer-2 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04936  Alcoholic liver disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    29896 (TRA2A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    29896 (TRA2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    29896 (TRA2A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    29896 (TRA2A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     29896 (TRA2A)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    29896 (TRA2A)
SSDB
Motif
Pfam: RRM_1 Apt1
Other DBs
NCBI-GeneID: 29896
NCBI-ProteinID: NP_037425
OMIM: 602718
HGNC: 16645
Ensembl: ENSG00000164548
Pharos: Q13595(Tbio)
UniProt: Q13595 Q549U1
LinkDB
Position
7:complement(23504780..23531981)
AA seq 282 aa
MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC
LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA
NGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYYDR
GYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
NT seq 849 nt   +upstreamnt  +downstreamnt
atgagtgatgtggaggaaaacaacttcgagggcagagagtctcgctctcagtcaaaatct
ccaacgggaactcctgctcgtgtaaaatcggagagcaggtcaggatctcgtagtccatca
agggtttccaaacactctgaatcccattctcgatcaagatcaaaatccaggtcgaggtca
aggagacattctcatagacgttacactcgatccagatcccactctcactctcataggaga
cgatctcgaagtagatcatatacaccagaataccggcggcgaaggagccgaagccattct
ccaatgtctaaccggagaagacatactggcagcagggcaaatccagatcccaacacttgc
cttggagtgtttggcctcagtttgtacacaacagagagggatcttcgtgaagtattttct
cgatatggaccattgagtggtgtcaatgtggtttatgatcagcgaactgggcgatctcga
ggatttgcttttgtgtattttgagagaatagatgactcaaaggaggctatggaaagggca
aatggaatggagctggatggtagaagaattcgggtggattattctataaccaagagagcg
cacacaccaacaccaggcatctacatgggcagaccaactcatagtggtgggggtggtgga
ggaggcggcggcggtggaggtggaggtggtggcagacgtcgagattcttactatgataga
ggatatgatcgtgggtatgacagatatgaagactatgattaccgatacagaagacgatca
ccttctccttattatagtcgatatagatcacgatcaagatctcgttcctacagcccaaga
cgctattga

KEGG   Homo sapiens (human): 6434
Entry
6434              CDS       T01001                                 
Symbol
TRA2B, Htra2-beta, PPP1R156, SFRS10, SRFS10, TRA2-BETA, TRAN2B
Name
(RefSeq) transformer 2 beta homolog
  KO
K12897  transformer-2 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04936  Alcoholic liver disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6434 (TRA2B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    6434 (TRA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    6434 (TRA2B)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6434 (TRA2B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6434 (TRA2B)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6434 (TRA2B)
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_3 Apt1
Other DBs
NCBI-GeneID: 6434
NCBI-ProteinID: NP_004584
OMIM: 602719
HGNC: 10781
Ensembl: ENSG00000136527
Pharos: P62995(Tbio)
UniProt: P62995
Structure
LinkDB
Position
3:complement(185914558..185938014)
AA seq 288 aa
MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRS
RRSSRRHYTRSRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCL
GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERAN
GMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRDYYSRSY
RGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRRY
NT seq 867 nt   +upstreamnt  +downstreamnt
atgagcgacagcggcgagcagaactacggcgagcgggaatcccgttctgcttccagaagt
ggaagtgctcacggatcggggaaatctgcaaggcatacccctgcaaggtctcgctccaag
gaagattccaggcgttccagatcaaagtccaggtcccgatctgaatctaggtctagatcc
agaagaagctcccgaaggcattatacccggtcacggtctcgctcccgctcccatagacga
tcacgtagcaggtcttacagtcgagattatcgtagacggcacagccacagccattctccc
atgtctactcgcaggcgtcatgttgggaatcgggcaaatcctgatcctaactgttgtctt
ggagtatttgggctgagcttgtacaccacagaaagagatctaagagaagtgttctctaaa
tatggtcccattgccgatgtgtctattgtatatgaccagcagtctaggcgttcaagagga
tttgcctttgtatattttgaaaatgtagatgatgccaaggaagctaaagaacgtgccaat
ggaatggagcttgatgggcgtaggatcagagttgatttctctataacaaaaagaccacat
acgccaacaccaggaatttacatggggagacctacctatggcagctctcgccgtcgggat
tactatgacagaggatatgatcggggctatgatgatcgggactactatagcagatcatac
agaggaggaggtggaggaggaggaggatggagagctgcccaagacagggatcagatttat
agaaggcggtcaccttctccttactatagtcgtggaggatacagatcacgttccagatct
cgatcatactcacctcgtcgctattaa

DBGET integrated database retrieval system