KEGG   Homo sapiens (human): 30001
Entry
30001             CDS       T01001                                 
Symbol
ERO1A, ERO1-L, ERO1-L-alpha, ERO1-alpha, ERO1L, ERO1LA, Ero1alpha
Name
(RefSeq) endoplasmic reticulum oxidoreductase 1 alpha
  KO
K10950  ERO1-like protein alpha [EC:1.8.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05110  Vibrio cholerae infection
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    30001 (ERO1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    30001 (ERO1A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    30001 (ERO1A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-
     30001 (ERO1A)
SSDB
Motif
Pfam: ERO1
Other DBs
NCBI-GeneID: 30001
NCBI-ProteinID: NP_055399
OMIM: 615435
HGNC: 13280
Ensembl: ENSG00000197930
Pharos: Q96HE7(Tbio)
UniProt: Q96HE7
Structure
LinkDB
Position
14:complement(52639915..52695558)
AA seq 468 aa
MGRGWGFLFGLLGAVWLLSSGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYR
LFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKY
SEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVD
LLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGTSEENTFYSWLEGL
CVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITEFQQRFDGILTEGEGPRR
LKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDE
NSFFAGDKKEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKL
IANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIH
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgggccgcggctggggattcttgtttggcctcctgggcgccgtgtggctgctcagctcg
ggccacggagaggagcagcccccggagacagcggcacagaggtgcttctgccaggttagt
ggttacttggatgattgtacctgtgatgttgaaaccattgatagatttaataactacagg
cttttcccaagactacaaaaacttcttgaaagtgactactttaggtattacaaggtaaac
ctgaagaggccgtgtcctttctggaatgacatcagccagtgtggaagaagggactgtgct
gtcaaaccatgtcaatctgatgaagttcctgatggaattaaatctgcgagctacaagtat
tctgaagaagccaataatctcattgaagaatgtgaacaagctgaacgacttggagcagtg
gatgaatctctgagtgaggaaacacagaaggctgttcttcagtggaccaagcatgatgat
tcttcagataacttctgtgaagctgatgacattcagtcccctgaagctgaatatgtagat
ttgcttcttaatcctgagcgctacactggttacaagggaccagatgcttggaaaatatgg
aatgtcatctacgaagaaaactgttttaagccacagacaattaaaagacctttaaatcct
ttggcttctggtcaagggacaagtgaagagaacactttttacagttggctagaaggtctc
tgtgtagaaaaaagagcattctacagacttatatctggcctacatgcaagcattaatgtg
catttgagtgcaagatatcttttacaagagacctggttagaaaagaaatggggacacaac
attacagaatttcaacagcgatttgatggaattttgactgaaggagaaggtccaagaagg
cttaagaacttgtattttctctacttaatagaactaagggctttatccaaagtgttacca
ttcttcgagcgcccagattttcaactctttactggaaataaaattcaggatgaggaaaac
aaaatgttacttctggaaatacttcatgaaatcaagtcatttcctttgcattttgatgag
aattcattttttgctggggataaaaaagaagcacacaaactaaaggaggactttcgactg
cattttagaaatatttcaagaattatggattgtgttggttgttttaaatgtcgtctgtgg
ggaaagcttcagactcagggtttgggcactgctctgaagatcttattttctgagaaattg
atagcaaatatgccagaaagtggacctagttatgaattccatctaaccagacaagaaata
gtatcattattcaacgcatttggaagaatttctacaagtgtgaaagaattagaaaacttc
aggaacttgttacagaatattcattaa

DBGET integrated database retrieval system