KEGG   Homo sapiens (human): 3053
Entry
3053              CDS       T01001                                 
Symbol
SERPIND1, D22S673, HC2, HCF2, HCII, HLS2, LS2, THPH10
Name
(RefSeq) serpin family D member 1
  KO
K03912  heparin cofactor II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Network
nt06514  Coagulation cascade
  Element
N01521  Regulation of coagulation cascade, HCF2
Disease
H00223  Inherited thrombophilia
Drug target
Heparin (DG00150): D02980
Sulodexide: D08547
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3053 (SERPIND1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    3053 (SERPIND1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3053 (SERPIND1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3053 (SERPIND1)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   3053 (SERPIND1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   3053 (SERPIND1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   3053 (SERPIND1)
SSDB
Motif
Pfam: Serpin AAA_9 CpsB_CapC
Other DBs
NCBI-GeneID: 3053
NCBI-ProteinID: NP_000176
OMIM: 142360
HGNC: 4838
Ensembl: ENSG00000099937
Pharos: P05546(Tbio)
UniProt: P05546 Q8IVC0
Structure
LinkDB
Position
22:20774113..20787720
AA seq 499 aa
MKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFH
KENTVTNDWIPEGEEDDDYLDLEKIFSEDDDYIDIVDSLSVSPTDSDVSAGNILQLFHGK
SRIQRLNILNAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSI
LHFKDFVNASSKYEITTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKV
REYYFAEAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWV
NKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVP
HKMSGMKTLEAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDK
NGNMAGISDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVRFTVDRPFLFLIY
EHRTSCLLFMGRVANPSRS
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgaaacactcattaaacgcacttctcattttcctcatcataacatctgcgtggggtggg
agcaaaggcccgctggatcagctagagaaaggaggggaaactgctcagtctgcagatccc
cagtgggagcagttaaataacaaaaacctgagcatgcctcttctccctgccgacttccac
aaggaaaacaccgtcaccaacgactggattccagagggggaggaggacgacgactatctg
gacctggagaagatattcagtgaagacgacgactacatcgacatcgtcgacagtctgtca
gtttccccgacagactctgatgtgagtgctgggaacatcctccagctttttcatggcaag
agccggatccagcgtcttaacatcctcaacgccaagttcgctttcaacctctaccgagtg
ctgaaagaccaggtcaacactttcgataacatcttcatagcacccgttggcatttctact
gcgatgggtatgatttccttaggtctgaagggagagacccatgaacaagtgcactcgatt
ttgcattttaaagactttgttaatgccagcagcaagtatgaaatcacgaccattcataat
ctcttccgtaagctgactcatcgcctcttcaggaggaattttgggtacacactgcggtca
gtcaatgacctttatatccagaagcagtttccaatcctgcttgacttcaaaactaaagta
agagagtattactttgctgaggcccagatagctgacttctcagaccctgccttcatatca
aaaaccaacaaccacatcatgaagctcaccaagggcctcataaaagatgctctggagaat
atagaccctgctacccagatgatgattctcaactgcatctacttcaaaggatcctgggtg
aataaattcccagtggaaatgacacacaaccacaacttccggctgaatgagagagaggta
gttaaggtttccatgatgcagaccaaggggaacttcctcgcagcaaatgaccaggagctg
gactgcgacatcctccagctggaatacgtggggggcatcagcatgctaattgtggtccca
cacaagatgtctgggatgaagaccctcgaagcgcaactgacaccccgggtggtggagaga
tggcaaaaaagcatgacaaacagaactcgagaagtgcttctgccgaaattcaagctggag
aagaactacaatctagtggagtccctgaagttgatggggatcaggatgctgtttgacaaa
aatggcaacatggcaggcatctcagaccaaaggatcgccatcgacctgttcaagcaccaa
ggcacgatcacagtgaacgaggaaggcacccaagccaccactgtgaccacggtggggttc
atgccgctgtccacccaagtccgcttcactgtcgaccgcccctttcttttcctcatctac
gagcatcgcaccagctgcctgctcttcatgggaagagtggccaaccccagcaggtcctag

DBGET integrated database retrieval system