KEGG   Homo sapiens (human): 30846
Entry
30846             CDS       T01001                                 
Symbol
EHD2, PAST2
Name
(RefSeq) EH domain containing 2
  KO
K12469  EH domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    30846 (EHD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    30846 (EHD2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    30846 (EHD2)
SSDB
Motif
Pfam: DUF5600 EF-hand_4 EHD_N Dynamin_N MMR_HSR1 EF-hand_1 GTP_EFTU
Other DBs
NCBI-GeneID: 30846
NCBI-ProteinID: NP_055416
OMIM: 605890
HGNC: 3243
Ensembl: ENSG00000024422
Pharos: Q9NZN4(Tbio)
UniProt: Q9NZN4 A0A024R0S6
LinkDB
Position
19:47713422..47743134
AA seq 543 aa
MFSWLKRGGARGQQPEAIRTVTSALKELYRTKLLPLEEHYRFGAFHSPALEDADFDGKPM
VLVAGQYSTGKTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGDTEGTVPGNALVVDPDK
PFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAE
RVDLIILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWAL
GKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFRDIQGLPRHAALRKLNDLVKR
ARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPVIFAKIQLEHHISPGDFPDCQKMQ
ELLMAHDFTKFHSLKPKLLEALDEMLTHDIAKLMPLLRQEELESTEVGVQGGAFEGTHMG
PFVERGPDEAMEDGEEGSDDEAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTK
LPNSVLGRIWKLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKG
SAE
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgttcagctggctgaagcggggcggggcacggggccagcagcccgaggccatccgcacg
gtgacctcggccctcaaggagctgtaccgcacgaagctgctgccgctggaggagcactac
cgctttggggccttccactcgccggccctggaggacgcagacttcgacggcaagcccatg
gtgctggtggccggccagtacagcacgggcaagaccagcttcatccagtacctgctggag
caggaggtgcccggctcccgcgtggggcctgagcccaccaccgactgctttgtggccgtc
atgcacggggacactgagggcaccgtgcccggcaacgccctcgtcgtggacccggacaag
cccttccgcaaactcaaccctttcggaaacaccttcctcaacaggttcatgtgtgcccag
ctccctaatcaggtcctggagagcatcagcatcatcgacaccccgggtatcctgtcgggt
gccaagcagagagtgagccgcggctacgacttcccggccgtgctgcgctggttcgcggag
cgcgtggacctcatcatcctgctctttgatgcgcacaagctggagatctcggacgagttc
tcagaggccatcggcgcgttgcggggccatgaggacaagatccgcgtggtgctcaacaag
gccgacatggtggagacgcagcagctgatgcgcgtctacggcgcgctcatgtgggcgctg
ggcaaggtggtgggcacgcccgaggtgctgcgcgtctacatcggctccttctggtcccag
cccctcctcgtgcccgacaaccggcgcctcttcgagctggaggagcaggacctcttccgc
gacatccagggcctgccccggcacgcagccttgcgcaagctcaacgacctggtgaagagg
gcccggctggtgcgagttcacgcttacatcatcagctacctgaagaaggagatgccctct
gtgtttgggaaggagaacaagaagaagcagctgatcctcaaactgcccgtcatctttgcg
aagattcagctggaacatcacatctcccctggggactttcctgattgccagaaaatgcag
gagctgctgatggcgcacgacttcaccaagtttcactcgctgaagccgaagctgctagag
gcactggacgagatgctgacgcacgacatcgccaagctcatgcccctgctgcggcaggag
gagctggagagcaccgaggtgggcgtgcaggggggcgcttttgagggcacccacatgggc
ccgtttgtggagcggggacctgacgaggccatggaggacggcgaggagggctcggacgac
gaggccgagtgggtggtgaccaaggacaagtccaaatacgacgagatcttctacaacctg
gcgcctgccgacggcaagctgagcggctccaaggccaagacctggatggtggggaccaag
ctccccaactcagtgctggggcgcatctggaagctcagcgatgtggaccgcgacggcatg
ctggatgatgaggagttcgcgctggccagccacctcatcgaggccaagctggaaggccac
gggctgcccgccaacctgccccgtcgcctggtgccaccctccaagcgacgccacaagggc
tccgccgagtga

DBGET integrated database retrieval system