KEGG   Homo sapiens (human): 3146
Entry
3146              CDS       T01001                                 

Gene name
HMGB1, HMG-1, HMG1, HMG3, SBP-1
Definition
(RefSeq) high mobility group box 1
  KO
K10802  high mobility group protein B1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
hsa04140  Autophagy - animal
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    3146 (HMGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    3146 (HMGB1)
  09143 Cell growth and death
   04217 Necroptosis
    3146 (HMGB1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    3146 (HMGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3146 (HMGB1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    3146 (HMGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3146 (HMGB1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    3146 (HMGB1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     3146 (HMGB1)
   MMR (mismatch excision repair)
    Other MMR factors
     3146 (HMGB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   3146 (HMGB1)
SSDB
Motif
Pfam: HMG_box HMG_box_2 HMG_box_5 NOA36 Nop14 TFIIA
Other DBs
NCBI-GeneID: 3146
NCBI-ProteinID: NP_001300821
OMIM: 163905
HGNC: 4983
Ensembl: ENSG00000189403
Vega: OTTHUMG00000016670
Pharos: P09429(Tbio)
UniProt: P09429 A0A024RDR0
LinkDB
Structure
PDB: 

Position
13q12.3
AA seq 215 aa
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
NT seq 648 nt   +upstreamnt  +downstreamnt
atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattttttgtg
caaacttgtcgggaggagcataagaagaagcacccagatgcttcagtcaacttctcagag
ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt
gaagatatggcaaaagcggacaaggcccgttatgaaagagaaatgaaaacctatatccct
cccaaaggggagacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg
gccttcttcctcttctgctctgagtatcgcccaaaaatcaaaggagaacatcctggcctg
tccattggtgatgttgcgaagaaactgggagagatgtggaataacactgctgcagatgac
aagcagccttatgaaaagaaggctgcgaagctgaaggaaaaatatgaaaaggatattgct
gcatatcgagctaaaggaaagcctgatgcagcaaaaaagggagttgtcaaggctgaaaaa
agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaggag
gaagatgaagaagatgaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system