KEGG   Homo sapiens (human): 3175
Entry
3175              CDS       T01001                                 
Symbol
ONECUT1, HNF-6, HNF6, HNF6A
Name
(RefSeq) one cut homeobox 1
  KO
K08026  one cut domain, family member 1 (hepatocyte nuclear factor 6)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3175 (ONECUT1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    3175 (ONECUT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3175 (ONECUT1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain CUT
    3175 (ONECUT1)
SSDB
Motif
Pfam: CUT Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 3175
NCBI-ProteinID: NP_004489
OMIM: 604164
HGNC: 8138
Ensembl: ENSG00000169856
Vega: OTTHUMG00000131899
Pharos: Q9UBC0(Tbio)
UniProt: Q9UBC0
LinkDB
Position
15:complement(52755053..52790336)
AA seq 465 aa
MNAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVAHRGSHLPPAHPRSMGMASLLD
GGSGGGDYHHHHRAPEHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSD
KFPHHHHHHHHHHHPHHHQRLAGNVSGSFTLMRDERGLASMNNLYTPYHKDVAGMGQSLS
PLSSSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAG
MVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEINTKEVAQR
ITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQ
RMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQ
QLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaacgcgcagctgaccatggaagcgatcggcgagctgcacggggtgagccatgagccg
gtgcccgcccctgccgacctgctgggcggcagcccccacgcgcgcagctccgtggcgcac
cgcggcagccacctgccccccgcgcacccgcgctccatgggcatggcgtccctgctggac
ggcggcagcggcggcggagattaccaccaccaccaccgggcccctgagcacagcctggcc
ggccccctgcatcccaccatgaccatggcctgcgagactcccccaggtatgagcatgccc
accacctacaccaccttgacccctctgcagccgctgcctcccatctccacagtctcggac
aagttcccccaccatcaccaccaccaccatcaccaccaccacccgcaccaccaccagcgc
ctggcgggcaacgtgagcggtagcttcacgctcatgcgggatgagcgcgggctggcctcc
atgaataacctctataccccctaccacaaggacgtggccggcatgggccagagcctctcg
cccctctccagctccggtctgggcagcatccacaactcccagcaagggctcccccactat
gcccacccgggggccgccatgcccaccgacaagatgctcacccccaacggcttcgaagcc
caccacccggccatgctcggccgccacggggagcagcacctcacgcccacctcggccggc
atggtgcccatcaacggccttcctccgcaccatccccacgcccacctgaacgcccagggc
cacgggcaactcctgggcacagcccgggagcccaacccttcggtgaccggcgcgcaggtc
agcaatggaagtaattcagggcagatggaagagatcaataccaaagaggtggcgcagcgt
atcaccaccgagctcaagcgctacagcatcccacaggccatcttcgcgcagagggtgctc
tgccgctcccaggggaccctctcggacctgctgcgcaaccccaaaccctggagcaaactc
aaatccggccgggagaccttccggaggatgtggaagtggctgcaggagccggagttccag
cgcatgtccgcgctccgcttagcagcatgcaaaaggaaagaacaagaacatgggaaggat
agaggcaacacacccaaaaagcccaggttggtcttcacagatgtccagcgtcgaactcta
catgcaatattcaaggaaaataagcgtccatccaaagaattgcaaatcaccatttcccag
cagctggggttggagctgagcactgtcagcaacttcttcatgaacgcaagaaggaggagt
ctggacaagtggcaggacgagggcagctccaattcaggcaactcatcttcttcatcaagc
acttgtaccaaagcatga

DBGET integrated database retrieval system