KEGG   Homo sapiens (human): 3198
Entry
3198              CDS       T01001                                 
Symbol
HOXA1, BSAS, HOX1, HOX1F
Name
(RefSeq) homeobox A1
  KO
K09301  homeobox protein HoxA/B/D1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Disease
H00727  Athabascan brainstem dysgenesis syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3198 (HOXA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3198 (HOXA1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    3198 (HOXA1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN PHC2_SAM_assoc
Other DBs
NCBI-GeneID: 3198
NCBI-ProteinID: NP_005513
OMIM: 142955
HGNC: 5099
Ensembl: ENSG00000105991
Vega: OTTHUMG00000023207
Pharos: P49639(Tbio)
UniProt: P49639
LinkDB
Position
7:complement(27092993..27096000)
AA seq 335 aa
MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQ
IGSPHHHHHHHHRHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVS
GGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSL
SPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQ
LTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATP
PGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggacaatgcaagaatgaactccttcctggaataccccatacttagcagtggcgactcg
gggacctgctcagcccgagcctacccctcggaccataggattacaactttccagtcgtgc
gcggtcagcgccaacagttgcggcggcgacgaccgcttcctagtgggcaggggggtgcag
atcggttcgccccaccaccaccaccaccaccaccatcgccacccccagccggctacctac
cagacttccgggaacctgggggtgtcctactcccactcaagttgtggtccaagctatggc
tcacagaacttcagtgcgccttacagcccctacgcgttaaatcaggaagcagacgtaagt
ggtgggtacccccagtgcgctcccgctgtttactctggaaatctctcatctcccatggtc
cagcatcaccaccaccaccagggttatgctgggggcgcggtgggctcgcctcaatacatt
caccactcatatggacaggagcaccagagcctggccctggctacgtataataactccttg
tcccctctccacgccagccaccaagaagcctgtcgctcccccgcatcggagacatcttct
ccagcgcagacttttgactggatgaaagtcaaaagaaaccctcccaaaacagggaaagtt
ggagagtacggctacctgggtcaacccaacgcggtgcgcaccaacttcactaccaagcag
ctcacggaactggagaaggagttccacttcaacaagtacctgacgcgcgcccgcagggtg
gagatcgctgcatccctgcagctcaacgagacccaagtgaagatctggttccagaaccgc
cgaatgaagcaaaagaaacgtgagaaggagggtctcttgcccatctctccggccaccccg
ccaggaaacgacgagaaggccgaggaatcctcagagaagtccagctcttcgccctgcgtt
ccttccccggggtcttctacctcagacactctgactacctcccactga

KEGG   Homo sapiens (human): 3211
Entry
3211              CDS       T01001                                 
Symbol
HOXB1, HCFP3, HOX2, HOX2I, Hox-2.9
Name
(RefSeq) homeobox B1
  KO
K09301  homeobox protein HoxA/B/D1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Disease
H02151  Hereditary congenital facial paresis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3211 (HOXB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3211 (HOXB1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    3211 (HOXB1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 3211
NCBI-ProteinID: NP_002135
OMIM: 142968
HGNC: 5111
Ensembl: ENSG00000120094
Vega: OTTHUMG00000159929
Pharos: P14653(Tbio)
UniProt: P14653
Structure
LinkDB
Position
17:complement(48528526..48531011)
AA seq 301 aa
MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQN
SGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQL
GGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTF
DWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATL
ELNETQVKIWFQNRRMKQKKREREEGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVT
S
NT seq 906 nt   +upstreamnt  +downstreamnt
atggactataataggatgaactccttcttagagtacccactctgtaaccggggacccagc
gcctacagcgcccacagcgccccaacctcctttcccccaagctcggctcaggcggttgac
agctatgcaagcgagggccgctacggtggggggctgtccagccctgcgtttcagcagaac
tccggctatcccgcccagcagccgccttcgaccctgggggtgcccttccccagctccgcg
ccctcggggtatgctcctgccgcctgcagccccagctacgggccttctcagtactaccct
ctgggtcaatcagaaggagacggaggctattttcatccctcgagctacggggcccagcta
gggggcttgtccgatggctacggagcaggtggagccggtccggggccatatcctccgcag
catcccccttatgggaacgagcagaccgcgagctttgcaccggcctatgctgatctcctc
tccgaggacaaggaaacaccctgcccttcagaacctaacacccccacggcccggaccttc
gactggatgaaggttaagagaaacccacccaagacagcgaaggtgtcagagccaggcctg
ggctcgcccagtggcctccgcaccaacttcaccacaaggcagctgacagaactggaaaag
gagttccatttcaacaagtacctgagccgggcccggagggtggagattgccgccaccctg
gagctcaatgaaacacaggtcaagatttggttccagaaccgacgaatgaagcagaagaag
cgcgagcgagaggaaggtcgggtccccccagccccaccaggctgccccaaggaggcagct
ggagatgcctcagaccagtcgacatgcacctccccggaagcctcacccagctctgtcacc
tcctga

KEGG   Homo sapiens (human): 3231
Entry
3231              CDS       T01001                                 
Symbol
HOXD1, HOX4, HOX4G, Hox-4.7
Name
(RefSeq) homeobox D1
  KO
K09301  homeobox protein HoxA/B/D1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3231 (HOXD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3231 (HOXD1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    3231 (HOXD1)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 3231
NCBI-ProteinID: NP_078777
OMIM: 142987
HGNC: 5132
Ensembl: ENSG00000128645
Vega: OTTHUMG00000132512
Pharos: Q9GZZ0(Tbio)
UniProt: Q9GZZ0 Q96CA4
LinkDB
Position
2:176188668..176190907
AA seq 328 aa
MSSYLEYVSCSSSGGVGGDVLSLAPKFCRSDARPVALQPAFPLGNGDGAFVSCLPLAAAR
PSPSPPAAPARPSVPPPAAPQYAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGV
LGRAADDGGSHVHYATSAVFSGGGSFLLSGQVDYAAFGEPGPFPACLKASADGHPGAFQT
ASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ
LTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVA
PLQLPLSGTTPTKFIKNPGSPSQSQEPS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgagctcctacctggagtacgtgtcatgcagcagcagcggcggggtcggcggcgacgtg
ctcagcttggcacccaagttctgccgctccgacgcccggcccgtggctctgcagcccgcc
ttccctctgggcaacggcgacggcgccttcgtcagctgtctgcccctggccgccgcccga
ccctcgccttcgcccccggccgcccccgcgcggccgtccgtaccgcctccggccgcgccc
cagtacgcgcagtgcaccctggagggggcctacgaacctggtgccgcacctgccgcggca
gctgggggcgcggactacggcttcctggggtccgggccggcgtacgacttcccgggcgtg
ctggggcgggcggccgacgacggcgggtctcacgtccactacgccacctcggccgtcttc
tcgggcggcggctctttcctcctcagcggccaggtggattacgcggccttcggcgaaccc
ggcccttttccggcttgtctcaaagcgtcagccgacggccaccctggtgctttccagacc
gcatccccggccccaggcacctaccccaagtccgtctctcccgcctccggcctccctgcc
gccttcagcacgttcgagtggatgaaagtgaagaggaatgcctctaagaaaggcaaactc
gccgagtatggggccgctagcccctccagcgcgatccgcacgaatttcagcaccaagcaa
ctgacagaactggaaaaagagtttcatttcaataagtacttaactcgagcccggcgcatc
gagatagccaactgcttgcacctgaatgacacgcaagtcaaaatctggttccagaaccgc
aggatgaaacagaagaaaagggaacgagaagggcttctggccacggccattcctgtggct
cccctccaacttcccctctctggaacaacccccactaagtttatcaagaaccccggcagc
ccttctcagtcccaagagccttcgtga

DBGET integrated database retrieval system