KEGG   Homo sapiens (human): 3276
Entry
3276              CDS       T01001                                 
Symbol
PRMT1, ANM1, HCP1, HRMT1L2, IR1B4
Name
(RefSeq) protein arginine methyltransferase 1
  KO
K11434  type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    3276 (PRMT1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    3276 (PRMT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3276 (PRMT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     3276 (PRMT1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     3276 (PRMT1)
SSDB
Motif
Pfam: PRMT_C Methyltransf_25 Methyltransf_11 PrmA Methyltransf_31 MTS Met_10 Methyltransf_23 Methyltransf_9 PRMT5 DOT1 FtsJ CMAS Methyltransf_12 PCMT Methyltransf_16 GidB
Other DBs
NCBI-GeneID: 3276
NCBI-ProteinID: NP_001527
OMIM: 602950
HGNC: 5187
Ensembl: ENSG00000126457
UniProt: Q99873
LinkDB
Position
19:49676153..49688447
AA seq 371 aa
MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHF
GIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECS
SISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYA
RDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVV
DPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTG
FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLC
ELSCSTDYRMR
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcggcagccgaggccgcgaactgcatcatggagaattttgtagccaccttggctaat
gggatgagcctccagccgcctcttgaagaagtgtcctgtggccaggcggaaagcagtgag
aagcccaacgctgaggacatgacatccaaagattactactttgactcctacgcacacttt
ggcatccacgaggagatgctgaaggacgaggtgcgcaccctcacttaccgcaactccatg
tttcataaccggcacctcttcaaggacaaggtggtgctggacgtcggctcgggcaccggc
atcctctgcatgtttgctgccaaggccggggcccgcaaggtcatcgggatcgagtgttcc
agtatctctgattatgcggtgaagatcgtcaaagccaacaagttagaccacgtggtgacc
atcatcaaggggaaggtggaggaggtggagctcccagtggagaaggtggacatcatcatc
agcgagtggatgggctactgcctcttctacgagtccatgctcaacaccgtgctctatgcc
cgggacaagtggctggcgcccgatggcctcatcttcccagaccgggccacgctgtatgtg
acggccatcgaggaccggcagtacaaagactacaagatccactggtgggagaacgtgtat
ggcttcgacatgtcttgcatcaaagatgtggccattaaggagcccctagtggatgtcgtg
gaccccaaacagctggtcaccaacgcctgcctcataaaggaggtggacatctataccgtc
aaggtggaagacctgaccttcacctccccgttctgcctgcaagtgaagcggaatgactac
gtgcacgccctggtggcctacttcaacatcgagttcacacgctgccacaagaggaccggc
ttctccaccagccccgagtccccgtacacgcactggaagcagacggtgttctacatggag
gactacctgaccgtgaagacgggcgaggagatcttcggcaccatcggcatgcggcccaac
gccaagaacaaccgggacctggacttcaccatcgacctggacttcaagggccagctgtgc
gagctgtcctgctccaccgactaccggatgcgctga

DBGET integrated database retrieval system