KEGG   Homo sapiens (human): 3303
Entry
3303              CDS       T01001                                 
Symbol
HSPA1A, HEL-S-103, HSP70, HSP70-1, HSP70-1A, HSP70-2, HSP70.1, HSP70.2, HSP70I, HSP72, HSPA1
Name
(RefSeq) heat shock protein family A (Hsp70) member 1A
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04010  MAPK signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04144  Endocytosis
hsa04213  Longevity regulating pathway - multiple species
hsa04612  Antigen processing and presentation
hsa04915  Estrogen signaling pathway
hsa05020  Prion disease
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05162  Measles
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    3303 (HSPA1A)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3303 (HSPA1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3303 (HSPA1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3303 (HSPA1A)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    3303 (HSPA1A)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3303 (HSPA1A)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    3303 (HSPA1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    3303 (HSPA1A)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    3303 (HSPA1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3303 (HSPA1A)
  09164 Neurodegenerative disease
   05020 Prion disease
    3303 (HSPA1A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3303 (HSPA1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3303 (HSPA1A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3303 (HSPA1A)
   03009 Ribosome biogenesis [BR:hsa03009]
    3303 (HSPA1A)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3303 (HSPA1A)
   04131 Membrane trafficking [BR:hsa04131]
    3303 (HSPA1A)
   03051 Proteasome [BR:hsa03051]
    3303 (HSPA1A)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3303 (HSPA1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3303 (HSPA1A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3303 (HSPA1A)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3303 (HSPA1A)
 Complex C
   Prp19-CDC5 complex
    3303 (HSPA1A)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3303 (HSPA1A)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3303 (HSPA1A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3303 (HSPA1A)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    3303 (HSPA1A)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3303 (HSPA1A)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3303 (HSPA1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3303 (HSPA1A)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A Radial_spoke_3
Other DBs
NCBI-GeneID: 3303
NCBI-ProteinID: NP_005336
OMIM: 140550
HGNC: 5232
Ensembl: ENSG00000204389
UniProt: P0DMV8 P0DMV9 A8K5I0 B3KTT5
Structure
LinkDB
Position
6:31815543..31817942
AA seq 641 aa
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggccaaagccgcggcgatcggcatcgacctgggcaccacctactcctgcgtgggggtg
ttccaacacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgattggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcctttccaggtgatcaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcattctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggtgtgatcgcggggctcaacgtgctgcggatcatcaacgagcccacggccgccgcc
atcgcctacggcctggacagaacgggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacctgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagagaaaacacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctacacgtccatcaccagggcg
aggttcgaggagctgtgctccgacctgttccgaagcaccctggagcccgtggagaaggct
ctgcgcgacgccaagctggacaaggcccagattcacgacctggtcctggtcgggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaaccccgacgaggctgtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggacgtggctcccctgtcg
ctggggctggagacggccggaggcgtgatgactgccctgatcaagcgcaactccaccatc
cccaccaagcagacgcagatcttcaccacctactccgacaaccaacccggggtgctgatc
caggtgtacgagggcgagagggccatgacgaaagacaacaatctgttggggcgcttcgag
ctgagcggcatccctccggcccccaggggcgtgccccagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccacggacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggcggagaagtacaaagcggaggacgaggtgcagcgcgagagggtgtcagccaagaac
gccctggagtcctacgccttcaacatgaagagcgccgtggaggatgaggggctcaagggc
aagatcagcgaggcggacaagaagaaggtgctggacaagtgtcaagaggtcatctcgtgg
ctggacgccaacaccttggccgagaaggacgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcatcagcggactgtaccagggtgccggtggtcccgggcctggg
ggcttcggggctcagggtcccaagggagggtctgggtcaggccccaccattgaggaggta
gattag

KEGG   Homo sapiens (human): 3304
Entry
3304              CDS       T01001                                 
Symbol
HSPA1B, HSP70-1, HSP70-1B, HSP70-2, HSP70.1, HSP70.2, HSP72, HSPA1, HSX70
Name
(RefSeq) heat shock protein family A (Hsp70) member 1B
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04010  MAPK signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04144  Endocytosis
hsa04213  Longevity regulating pathway - multiple species
hsa04612  Antigen processing and presentation
hsa04915  Estrogen signaling pathway
hsa05020  Prion disease
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05162  Measles
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    3304 (HSPA1B)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3304 (HSPA1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3304 (HSPA1B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3304 (HSPA1B)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    3304 (HSPA1B)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3304 (HSPA1B)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    3304 (HSPA1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    3304 (HSPA1B)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    3304 (HSPA1B)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3304 (HSPA1B)
  09164 Neurodegenerative disease
   05020 Prion disease
    3304 (HSPA1B)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3304 (HSPA1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3304 (HSPA1B)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3304 (HSPA1B)
   03009 Ribosome biogenesis [BR:hsa03009]
    3304 (HSPA1B)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3304 (HSPA1B)
   04131 Membrane trafficking [BR:hsa04131]
    3304 (HSPA1B)
   03051 Proteasome [BR:hsa03051]
    3304 (HSPA1B)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3304 (HSPA1B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3304 (HSPA1B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3304 (HSPA1B)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3304 (HSPA1B)
 Complex C
   Prp19-CDC5 complex
    3304 (HSPA1B)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3304 (HSPA1B)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3304 (HSPA1B)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3304 (HSPA1B)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    3304 (HSPA1B)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3304 (HSPA1B)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3304 (HSPA1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3304 (HSPA1B)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A Radial_spoke_3
Other DBs
NCBI-GeneID: 3304
NCBI-ProteinID: NP_005337
OMIM: 603012
HGNC: 5233
Ensembl: ENSG00000204388
Pharos: P0DMV8(Tchem) P0DMV9(Tbio)
UniProt: P0DMV8 P0DMV9 A8K5I0
Structure
LinkDB
Position
6:31827738..31830254
AA seq 641 aa
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggccaaagccgcggcgatcggcatcgacctgggcaccacctactcctgcgtgggggtg
ttccaacacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgattggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcctttccaggtgatcaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcattctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggtgtgatcgcggggctcaacgtgctgcggatcatcaacgagcccacggccgccgcc
atcgcctacggcctggacagaacgggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacctgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagagaaaacacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctacacgtccatcaccagggcg
aggttcgaggagctgtgctccgacctgttccgaagcaccctggagcccgtggagaaggct
ctgcgcgacgccaagctggacaaggcccagattcacgacctggtcctggtcgggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaaccccgacgaggctgtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggacgtggctcccctgtcg
ctggggctggagacggccggaggcgtgatgactgccctgatcaagcgcaactccaccatc
cccaccaagcagacgcagatcttcaccacctactccgacaaccaacccggggtgctgatc
caggtgtacgagggcgagagggccatgacgaaagacaacaatctgttggggcgcttcgag
ctgagcggcatccctccggcccccaggggcgtgccccagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccacggacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggcggagaagtacaaagcggaggacgaggtgcagcgcgagagggtgtcagccaagaac
gccctggagtcctacgccttcaacatgaagagcgccgtggaggatgaggggctcaagggc
aagatcagcgaggcggacaagaagaaggttctggacaagtgtcaagaggtcatctcgtgg
ctggacgccaacaccttggccgagaaggacgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcatcagcggactgtaccagggtgccggtggtcccgggcctggc
ggcttcggggctcagggtcccaagggagggtctgggtcaggccctaccattgaggaggtg
gattag

KEGG   Homo sapiens (human): 3305
Entry
3305              CDS       T01001                                 
Symbol
HSPA1L, HSP70-1L, HSP70-HOM, HSP70T, hum70t
Name
(RefSeq) heat shock protein family A (Hsp70) member 1 like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04010  MAPK signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04144  Endocytosis
hsa04213  Longevity regulating pathway - multiple species
hsa04612  Antigen processing and presentation
hsa04915  Estrogen signaling pathway
hsa05020  Prion disease
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05162  Measles
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    3305 (HSPA1L)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3305 (HSPA1L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3305 (HSPA1L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3305 (HSPA1L)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    3305 (HSPA1L)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3305 (HSPA1L)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    3305 (HSPA1L)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    3305 (HSPA1L)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    3305 (HSPA1L)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3305 (HSPA1L)
  09164 Neurodegenerative disease
   05020 Prion disease
    3305 (HSPA1L)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3305 (HSPA1L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3305 (HSPA1L)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3305 (HSPA1L)
   03009 Ribosome biogenesis [BR:hsa03009]
    3305 (HSPA1L)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3305 (HSPA1L)
   04131 Membrane trafficking [BR:hsa04131]
    3305 (HSPA1L)
   03051 Proteasome [BR:hsa03051]
    3305 (HSPA1L)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3305 (HSPA1L)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3305 (HSPA1L)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3305 (HSPA1L)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3305 (HSPA1L)
 Complex C
   Prp19-CDC5 complex
    3305 (HSPA1L)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3305 (HSPA1L)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3305 (HSPA1L)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3305 (HSPA1L)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    3305 (HSPA1L)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3305 (HSPA1L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3305 (HSPA1L)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3305 (HSPA1L)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Other DBs
NCBI-GeneID: 3305
NCBI-ProteinID: NP_005518
OMIM: 140559
HGNC: 5234
Ensembl: ENSG00000204390
Pharos: P34931(Tbio)
UniProt: P34931 A0A1U9X7W7
Structure
LinkDB
Position
6:complement(31809619..31815283)
AA seq 641 aa
MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEE
ISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAA
KNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE
LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggctactgccaagggaatcgccataggcatcgacctgggcaccacctactcctgtgtg
ggggtgttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacc
cccagctacgtggccttcacagacaccgagcggctcattggggatgcggccaagaaccag
gtagcaatgaatccccagaacactgtttttgatgctaaacgtctgatcggcaggaaattt
aatgatcctgttgtacaagcagatatgaaactttggccttttcaagtgattaatgaagga
ggcaagcccaaagtccttgtgtcctacaaaggggagaataaagctttctaccctgaggaa
atctcttcgatggtattgactaagttgaaggagactgctgaggcctttttgggccaccct
gtcaccaatgcagtgattaccgtgccagcctatttcaatgactctcaacgtcaggctact
aaggatgcaggtgtgattgctggacttaatgtgctaagaatcatcaatgagcccacggct
gctgccattgcctatggtttagataaaggaggtcaaggagaacgacatgtcctgattttt
gatctgggtggaggcacatttgatgtgtcaattctgaccatagatgatgggatttttgag
gtaaaggccactgctggggacactcacctgggtggggaggactttgacaacaggcttgtg
agccacttcgtggaggagttcaagaggaaacacaaaaaggacatcagccagaacaagcga
gccgtgaggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacc
caggccaacctagaaattgattcactttatgaaggcattgacttctatacatccatcacc
agagctcgatttgaagagttgtgtgcagacctgtttaggggtaccctggagcctgtagaa
aaagcgcttcgggatgccaagatggataaggctaaaatccatgacattgttttagtaggg
ggctccacccgcatccccaaggtgcagcggctgcttcaggactacttcaatggacgtgat
ctcaacaagagcatcaaccctgatgaggccgtagcatatggggctgcggtacaagcagcc
atcctgatgggggacaagtctgagaaggtacaggacctgctgctgctggacgtggctccc
ctgtccctggggctggagacggctgggggcgtgatgactgccctgataaagcgcaactcc
accatccccaccaagcagacacagattttcaccacctactctgacaaccaacccggggtg
ctgatccaggtgtatgagggcgagagggccatgacaaaggacaacaacctgctggggcgg
tttgacctgactggaatccctccagcacccaggggagttcctcagatcgaggtgacgttt
gacattgatgccaatggtattctcaatgtcacagccacggacaagagcaccggcaaggtg
aacaagatcaccatcaccaatgacaagggccgcctgagcaaggaggagattgagcgcatg
gttctggatgctgagaaatataaagctgaagatgaggtccagagggagaaaattgctgca
aagaatgccttagaatcctatgcttttaacatgaagagtgttgtgagtgatgaaggtttg
aagggcaagattagtgagtctgataaaaataaaatattggataaatgcaacgagctcctt
tcgtggctggaggtcaatcaactggcagagaaagatgagtttgatcataagagaaaggaa
ttggagcagatgtgtaaccctatcatcacaaaactctaccaaggaggatgcactgggcct
gcctgcggaacagggtatgtgcctggaaggcctgccacaggccccacaattgaagaagta
gattaa

KEGG   Homo sapiens (human): 3306
Entry
3306              CDS       T01001                                 
Symbol
HSPA2, HSP70-2, HSP70-3
Name
(RefSeq) heat shock protein family A (Hsp70) member 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04010  MAPK signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04144  Endocytosis
hsa04213  Longevity regulating pathway - multiple species
hsa04612  Antigen processing and presentation
hsa04915  Estrogen signaling pathway
hsa05020  Prion disease
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05162  Measles
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    3306 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3306 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3306 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3306 (HSPA2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    3306 (HSPA2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3306 (HSPA2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    3306 (HSPA2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    3306 (HSPA2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    3306 (HSPA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3306 (HSPA2)
  09164 Neurodegenerative disease
   05020 Prion disease
    3306 (HSPA2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3306 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3306 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3306 (HSPA2)
   03009 Ribosome biogenesis [BR:hsa03009]
    3306 (HSPA2)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3306 (HSPA2)
   04131 Membrane trafficking [BR:hsa04131]
    3306 (HSPA2)
   03051 Proteasome [BR:hsa03051]
    3306 (HSPA2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3306 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3306 (HSPA2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3306 (HSPA2)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3306 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    3306 (HSPA2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3306 (HSPA2)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3306 (HSPA2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3306 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    3306 (HSPA2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3306 (HSPA2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3306 (HSPA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3306 (HSPA2)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A DUF1464 DDR CRIC_ras_sig
Other DBs
NCBI-GeneID: 3306
NCBI-ProteinID: NP_068814
OMIM: 140560
HGNC: 5235
Ensembl: ENSG00000126803
Pharos: P54652(Tbio)
UniProt: P54652 A0A024R6B5
Structure
LinkDB
Position
14:64535905..64543237
AA seq 639 aa
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI
SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEEVD
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgtctgcccgtggcccggctatcggcatcgacctgggcaccacctattcgtgcgtcggg
gtcttccaacatggcaaggtggagatcatcgccaacgaccagggcaatcgcaccaccccc
agctacgtggccttcacggacaccgagcgcctcatcggcgacgccgccaagaaccaggtg
gccatgaaccccaccaacaccatcttcgacgccaagaggctgattggacggaaattcgag
gatgccacagtgcagtcggatatgaaacactggccgttccgggtggtgagcgagggaggc
aagcccaaagtgcaagtagagtacaagggggagaccaagaccttcttcccagaggagata
tcctccatggtcctcacgaagatgaaggagatcgcggaagcctacctggggggcaaggtg
cacagcgcggtcataacggtcccggcctatttcaacgactcgcagcgccaggccaccaag
gacgcaggcaccatcacggggctcaatgtgctgcgcatcatcaacgagcccacggcggcg
gccatcgcctacggcctggacaagaagggctgcgcgggcggcgagaagaacgtgctcatc
tttgacctgggcggtggcactttcgacgtgtccatcctgaccatcgaggatggcatcttc
gaggtgaagtccacggccggcgacacccacctgggcggtgaggacttcgacaaccgcatg
gtgagccacctggcggaggagttcaagcgcaagcacaagaaggacattgggcccaacaag
cgcgccgtgaggcggctgcgcaccgcttgcgagcgcgccaagcgcaccctgagctcgtcc
acgcaggcgagcatcgagatcgactcgctctacgagggcgtggacttctatacgtccatc
acgcgcgcccgcttcgaggagctcaatgccgacctctttcgcgggaccctggagccggtg
gagaaggcgctgcgcgacgccaagctggacaagggccagatccaggagatcgtgctggtg
ggcggctccactcgtatccccaagatccagaagctgctgcaggatttcttcaacggcaag
gagctgaacaagagcatcaaccccgacgaggcggtggcctatggcgccgcggtgcaggcg
gccatcctcatcggcgacaaatcagagaatgtgcaggacctgctgctactcgacgtgacc
ccgttgtcgctgggcatcgagacagctggcggtgtcatgaccccactcatcaagaggaac
accacgatccccaccaagcagacgcagaccttcaccacctactcggacaaccagagcagc
gtactggtgcaggtatacgagggcgaacgggccatgaccaaggacaataacctgctgggc
aagttcgacctgaccgggattccccctgcgcctcgcggggtcccccaaatcgaggttacc
ttcgacattgacgccaatggcatccttaacgttaccgccgccgacaagagcaccggtaag
gaaaacaaaatcaccatcaccaatgacaaaggtcgtctgagcaaggacgacattgaccgg
atggtgcaggaggcggagcggtacaaatcggaagatgaggcgaatcgcgaccgagtcgcg
gccaaaaacgccctggagtcctatacctacaacatcaagcagacggtggaagacgagaaa
ctgaggggcaagattagcgagcaggacaaaaacaagatcctcgacaagtgtcaggaggtg
atcaactggctcgaccgaaaccagatggcagagaaagatgagtatgaacacaagcagaaa
gagctcgaaagagtttgcaaccccatcatcagcaaactttaccaaggtggtcctggcggc
ggcagcggcggcggcggttcaggagcctccgggggacccaccatcgaagaagtggactaa

KEGG   Homo sapiens (human): 3308
Entry
3308              CDS       T01001                                 
Symbol
HSPA4, APG-2, HEL-S-5a, HS24/P52, HSPH2, RY, hsp70, hsp70RY
Name
(RefSeq) heat shock protein family A (Hsp70) member 4
  KO
K09489  heat shock 70kDa protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04612  Antigen processing and presentation
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    3308 (HSPA4)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    3308 (HSPA4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3308 (HSPA4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3308 (HSPA4)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3308 (HSPA4)
SSDB
Motif
Pfam: HSP70 MreB_Mbl F-box-like_2 Herpes_ICP4_N
Other DBs
NCBI-GeneID: 3308
NCBI-ProteinID: NP_002145
OMIM: 601113
HGNC: 5237
Ensembl: ENSG00000170606
Pharos: P34932(Tbio)
UniProt: P34932
LinkDB
Position
5:133052013..133106449
AA seq 840 aa
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNA
KNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAM
LLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALA
YGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVL
VNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSANASDLPLSIECFMNDVDVSGT
MNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAVKEKISKFFGK
ELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVF
SKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKV
KVRVNVHGIFSVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVDQEEPHVEEQQQQTPA
ENKAESEEMETSQAGSKDKKMDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIEN
EGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGEYEKFVSEDDRNSFTLKLEDTENWLY
EDGEDQPKQVYVDKLAELKNLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKE
DQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCS
PIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgtcggtggtgggcatagacctgggcttccagagctgctacgtcgctgtggcccgcgcc
ggcggcatcgagactatcgctaatgagtatagcgaccgctgcacgccggcttgcatttct
tttggtcctaagaatcgttcaattggagcagcagctaaaagccaggtaatttctaatgca
aagaacacagtccaaggatttaaaagattccatggccgagcattctctgatccatttgtg
gaggcagaaaaatctaaccttgcatatgatattgtgcagttgcctacaggattaacaggt
ataaaggtgacatatatggaggaagagcgaaattttaccactgagcaagtgactgccatg
cttttgtccaaactgaaggagacagccgaaagtgttcttaagaagcctgtagttgactgt
gttgtttcggttccttgtttctatactgatgcagaaagacgatcagtgatggatgcaaca
cagattgctggtcttaattgcttgcgattaatgaatgaaaccactgcagttgctcttgca
tatggaatctataagcaggatcttcctgccttagaagagaaaccaagaaatgtagttttt
gtagacatgggccactctgcttatcaagtttctgtatgtgcatttaatagaggaaaactg
aaagttctggccactgcatttgacacgacattgggaggtagaaaatttgatgaagtgtta
gtaaatcacttctgtgaagaatttgggaagaaatacaagctagacattaagtccaaaatc
cgtgcattattacgactctctcaggagtgtgagaaactcaagaaattgatgagtgcaaat
gcttcagatctccctttgagcattgaatgttttatgaatgatgttgatgtatctggaact
atgaatagaggcaaatttctggagatgtgcaatgatctcttagctagagtggagccacca
cttcgtagtgttttggaacaaaccaagttaaagaaagaagatatttatgcagtggagata
gttggtggtgctacacgaatccctgcggtaaaagagaagatcagcaaatttttcggtaaa
gaacttagtacaacattaaatgctgatgaagctgtcactcgaggctgtgcattgcagtgt
gccatcttatcgcctgctttcaaagtcagagaattttctatcactgatgtagtaccatat
ccaatatctctgagatggaattctccagctgaagaagggtcaagtgactgtgaagtcttt
tccaaaaatcatgctgctcctttctctaaagttcttacattttatagaaaggaacctttc
actcttgaggcctactacagctctcctcaggatttgccctatccagatcctgctatagct
cagttttcagttcagaaagtcactcctcagtctgatggctccagttcaaaagtgaaagtc
aaagttcgagtaaatgtccatggcattttcagtgtgtccagtgcatctttagtggaggtt
cacaagtctgaggaaaatgaggagccaatggaaacagatcagaatgcaaaggaggaagag
aagatgcaagtggaccaggaggaaccacatgttgaagagcaacagcagcagacaccagca
gaaaataaggcagagtctgaagaaatggagacctctcaagctggatccaaggataaaaag
atggaccaaccaccccaagccaagaaggcaaaagtgaagaccagtactgtggacctgcca
atcgagaatcagctattatggcagatagacagagagatgctcaacttgtacattgaaaat
gagggtaagatgatcatgcaggataaactggagaaggagcggaatgatgctaagaacgca
gtggaggaatatgtgtatgaaatgagagacaagcttagtggtgaatatgagaagtttgtg
agtgaagatgatcgtaacagttttactttgaaactggaagatactgaaaattggttgtat
gaggatggagaagaccagccaaagcaagtttatgttgataagttggctgaattaaaaaat
ctaggtcaacctattaagatacgtttccaggaatctgaagaacgaccaaaattatttgaa
gaactagggaaacagatccaacagtatatgaaaataatcagctctttcaaaaacaaggag
gaccagtatgatcatttggatgctgctgacatgacaaaggtagaaaaaagcacaaatgaa
gcaatggagtggatgaataacaagctaaatctgcagaacaagcagagtttgaccatggat
ccagttgtcaagtcaaaagagattgaagctaaaattaaggagctgacaagtacttgtagc
cctataatttcaaagcccaaacccaaagtggaacctccaaaagaggaacaaaaaaatgca
gagcagaatggaccagtggatggacaaggagacaacccaggcccccaggctgctgagcag
ggtacagacacagctgtgccttcggattcagacaagaagcttcctgaaatggacattgat
tga

KEGG   Homo sapiens (human): 3310
Entry
3310              CDS       T01001                                 
Symbol
HSPA6, HSP70B'
Name
(RefSeq) heat shock protein family A (Hsp70) member 6
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04010  MAPK signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04144  Endocytosis
hsa04213  Longevity regulating pathway - multiple species
hsa04612  Antigen processing and presentation
hsa04915  Estrogen signaling pathway
hsa05020  Prion disease
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05162  Measles
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    3310 (HSPA6)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3310 (HSPA6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3310 (HSPA6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3310 (HSPA6)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    3310 (HSPA6)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3310 (HSPA6)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    3310 (HSPA6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    3310 (HSPA6)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    3310 (HSPA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3310 (HSPA6)
  09164 Neurodegenerative disease
   05020 Prion disease
    3310 (HSPA6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3310 (HSPA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3310 (HSPA6)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3310 (HSPA6)
   03009 Ribosome biogenesis [BR:hsa03009]
    3310 (HSPA6)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3310 (HSPA6)
   04131 Membrane trafficking [BR:hsa04131]
    3310 (HSPA6)
   03051 Proteasome [BR:hsa03051]
    3310 (HSPA6)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3310 (HSPA6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3310 (HSPA6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3310 (HSPA6)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3310 (HSPA6)
 Complex C
   Prp19-CDC5 complex
    3310 (HSPA6)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3310 (HSPA6)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3310 (HSPA6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3310 (HSPA6)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    3310 (HSPA6)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3310 (HSPA6)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3310 (HSPA6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3310 (HSPA6)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A DUF1464
Other DBs
NCBI-GeneID: 3310
NCBI-ProteinID: NP_002146
OMIM: 140555
HGNC: 5239
Ensembl: ENSG00000173110
Pharos: P17066(Tbio)
UniProt: P17066 B3KSM6 A0A384NKX5
Structure
LinkDB
Position
1:161524540..161526894
AA seq 643 aa
MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQ
AALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLV
NHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKE
LNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA
TIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTF
DIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAA
KNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRE
LEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgcaggccccacgggagctcgcggtgggcatcgacctgggcaccacctactcgtgcgtg
ggcgtgtttcagcagggccgcgtggagatcctggccaacgaccagggcaaccgcaccacg
cccagctacgtggccttcaccgacaccgagcggctggtcggggacgcggccaagagccag
gcggccctgaacccccacaacaccgtgttcgatgccaagcggctgatcgggcgcaagttc
gcggacaccacggtgcagtcggacatgaagcactggcccttccgggtggtgagcgagggc
ggcaagcccaaggtgcgcgtatgctaccgcggggaggacaagacgttctaccccgaggag
atctcgtccatggtgctgagcaagatgaaggagacggccgaggcgtacctgggccagccc
gtgaagcacgcagtgatcaccgtgcccgcctatttcaatgactcgcagcgccaggccacc
aaggacgcgggggccatcgcggggctcaacgtgttgcggatcatcaatgagcccacggca
gctgccatcgcctatgggctggaccggcggggcgcgggagagcgcaacgtgctcattttt
gacctgggtgggggcaccttcgatgtgtcggttctctccattgacgctggtgtctttgag
gtgaaagccactgctggagatacccacctgggaggagaggacttcgacaaccggctcgtg
aaccacttcatggaagaattccggcggaagcatgggaaggacctgagcgggaacaagcgt
gccctgcgcaggctgcgcacagcctgtgagcgcgccaagcgcaccctgtcctccagcacc
caggccaccctggagatagactccctgttcgagggcgtggacttctacacgtccatcact
cgtgcccgctttgaggaactgtgctcagacctcttccgcagcaccctggagccggtggag
aaggccctgcgggatgccaagctggacaaggcccagattcatgacgtcgtcctggtgggg
ggctccacacgcatccccaaggtgcagaagttgctgcaggacttcttcaacggcaaggag
ctgaacaagagcatcaaccctgatgaggctgtggcctatggggctgctgtgcaggcggcc
gtgttgatgggggacaaatgtgagaaagtgcaggatctcctgctgctggatgtggctccc
ctgtctctggggctggagacagcaggtggggtgatgaccacgctgatccagaggaacgcc
actatccccaccaagcagacccagactttcaccacctactcggacaaccagcctggggtc
ttcatccaggtgtatgagggtgagagggccatgaccaaggacaacaacctgctggggcgt
tttgaactcagtggcatccctcctgccccacgtggagtcccccagatagaggtgactttt
gacattgatgctaatggcatcctgagcgtgacagccactgacaggagcacaggtaaggct
aacaagatcaccatcaccaatgacaagggccggctgagcaaggaggaggtggagaggatg
gttcatgaagccgagcagtacaaggctgaggatgaggcccagagggacagagtggctgcc
aaaaactcgctggaggcccatgtcttccatgtgaaaggttctttgcaagaggaaagcctt
agggacaagattcccgaagaggacaggcgcaaaatgcaagacaagtgtcgggaagtcctt
gcctggctggagcacaaccagctggcagagaaggaggagtatgagcatcagaagagggag
ctggagcaaatctgtcgccccatcttctccaggctctatggggggcctggtgtccctggg
ggcagcagttgtggcactcaagcccgccagggggaccccagcaccggccccatcattgag
gaggttgattga

KEGG   Homo sapiens (human): 3312
Entry
3312              CDS       T01001                                 
Symbol
HSPA8, HEL-33, HEL-S-72p, HSC54, HSC70, HSC71, HSP71, HSP73, HSPA10, LAP-1, LAP1, NIP71
Name
(RefSeq) heat shock protein family A (Hsp70) member 8
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04010  MAPK signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04144  Endocytosis
hsa04213  Longevity regulating pathway - multiple species
hsa04612  Antigen processing and presentation
hsa04915  Estrogen signaling pathway
hsa05020  Prion disease
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05162  Measles
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    3312 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3312 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3312 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3312 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    3312 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3312 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    3312 (HSPA8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    3312 (HSPA8)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    3312 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3312 (HSPA8)
  09164 Neurodegenerative disease
   05020 Prion disease
    3312 (HSPA8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3312 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3312 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3312 (HSPA8)
   03009 Ribosome biogenesis [BR:hsa03009]
    3312 (HSPA8)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3312 (HSPA8)
   04131 Membrane trafficking [BR:hsa04131]
    3312 (HSPA8)
   03051 Proteasome [BR:hsa03051]
    3312 (HSPA8)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3312 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3312 (HSPA8)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3312 (HSPA8)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3312 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    3312 (HSPA8)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3312 (HSPA8)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3312 (HSPA8)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3312 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    3312 (HSPA8)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3312 (HSPA8)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3312 (HSPA8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3312 (HSPA8)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA Radial_spoke_3
Other DBs
NCBI-GeneID: 3312
NCBI-ProteinID: NP_006588
OMIM: 600816
HGNC: 5241
Ensembl: ENSG00000109971
Pharos: P11142(Tchem)
UniProt: P11142 V9HW22 Q53HF2
Structure
LinkDB
Position
11:complement(123057489..123062462)
AA seq 646 aa
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgtccaagggacctgcagttggtattgatcttggcaccacctactcttgtgtgggtgtt
ttccagcacggaaaagtcgagataattgccaatgatcagggaaaccgaaccactccaagc
tatgtcgcctttacggacactgaacggttgatcggtgatgccgcaaagaatcaagttgca
atgaaccccaccaacacagtttttgatgccaaacgtctgattggacgcagatttgatgat
gctgttgtccagtctgatatgaaacattggccctttatggtggtgaatgatgctggcagg
cccaaggtccaagtagaatacaagggagagaccaaaagcttctatccagaggaggtgtct
tctatggttctgacaaagatgaaggaaattgcagaagcctaccttgggaagactgttacc
aatgctgtggtcacagtgccagcttactttaatgactctcagcgtcaggctaccaaagat
gctggaactattgctggtctcaatgtacttagaattattaatgagccaactgctgctgct
attgcttacggcttagacaaaaaggttggagcagaaagaaacgtgctcatctttgacctg
ggaggtggcacttttgatgtgtcaatcctcactattgaggatggaatctttgaggtcaag
tctacagctggagacacccacttgggtggagaagattttgacaaccgaatggtcaaccat
tttattgctgagtttaagcgcaagcataagaaggacatcagtgagaacaagagagctgta
agacgcctccgtactgcttgtgaacgtgctaagcgtaccctctcttccagcacccaggcc
agtattgagatcgattctctctatgaaggaatcgacttctatacctccattacccgtgcc
cgatttgaagaactgaatgctgacctgttccgtggcaccctggacccagtagagaaagcc
cttcgagatgccaaactagacaagtcacagattcatgatattgtcctggttggtggttct
actcgtatccccaagattcagaagcttctccaagacttcttcaatggaaaagaactgaat
aagagcatcaaccctgatgaagctgttgcttatggtgcagctgtccaggcagccatcttg
tctggagacaagtctgagaatgttcaagatttgctgctcttggatgtcactcctctttcc
cttggtattgaaactgctggtggagtcatgactgtcctcatcaagcgtaataccaccatt
cctaccaagcagacacagaccttcactacctattctgacaaccagcctggtgtgcttatt
caggtttatgaaggcgagcgtgccatgacaaaggataacaacctgcttggcaagtttgaa
ctcacaggcatacctcctgcaccccgaggtgttcctcagattgaagtcacttttgacatt
gatgccaatggtatactcaatgtctctgctgtggacaagagtacgggaaaagagaacaag
attactatcactaatgacaagggccgtttgagcaaggaagacattgaacgtatggtccag
gaagctgagaagtacaaagctgaagatgagaagcagagggacaaggtgtcatccaagaat
tcacttgagtcctatgccttcaacatgaaagcaactgttgaagatgagaaacttcaaggc
aagattaacgatgaggacaaacagaagattctggacaagtgtaatgaaattatcaactgg
cttgataagaatcagactgctgagaaggaagaatttgaacatcaacagaaagagctggag
aaagtttgcaaccccatcatcaccaagctgtaccagagtgcaggaggcatgccaggagga
atgcctgggggatttcctggtggtggagctcctccctctggtggtgcttcctcagggccc
accattgaagaggttgattaa

KEGG   Homo sapiens (human): 3320
Entry
3320              CDS       T01001                                 
Symbol
HSP90AA1, EL52, HEL-S-65p, HSP86, HSP89A, HSP90A, HSP90N, HSPC1, HSPCA, HSPCAL1, HSPCAL4, HSPN, Hsp103, Hsp89, Hsp90, LAP-2, LAP2
Name
(RefSeq) heat shock protein 90 alpha family class A member 1
  KO
K04079  molecular chaperone HtpG
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04612  Antigen processing and presentation
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa05132  Salmonella infection
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05215  Prostate cancer
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Alvespimycin hydrochloride: D06554
Ganetespib: D10126
Luminespib (DG01842): D10646 D10647
Onalespib (DG03099): D10719 D11766
Pimitespib: D11920<JP>
Retaspimycin (DG01880): D09375 D09376
Tanespimycin: D06650
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3320 (HSP90AA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3320 (HSP90AA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3320 (HSP90AA1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    3320 (HSP90AA1)
   04612 Antigen processing and presentation
    3320 (HSP90AA1)
   04659 Th17 cell differentiation
    3320 (HSP90AA1)
   04657 IL-17 signaling pathway
    3320 (HSP90AA1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3320 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    3320 (HSP90AA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3320 (HSP90AA1)
   05207 Chemical carcinogenesis - receptor activation
    3320 (HSP90AA1)
  09162 Cancer: specific types
   05215 Prostate cancer
    3320 (HSP90AA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    3320 (HSP90AA1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3320 (HSP90AA1)
   05418 Fluid shear stress and atherosclerosis
    3320 (HSP90AA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3320 (HSP90AA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3320 (HSP90AA1)
   04131 Membrane trafficking [BR:hsa04131]
    3320 (HSP90AA1)
   03051 Proteasome [BR:hsa03051]
    3320 (HSP90AA1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3320 (HSP90AA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3320 (HSP90AA1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3320 (HSP90AA1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP90
   3320 (HSP90AA1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    3320 (HSP90AA1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3320 (HSP90AA1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    3320 (HSP90AA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3320 (HSP90AA1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Zip LOH1CR12
Other DBs
NCBI-GeneID: 3320
NCBI-ProteinID: NP_005339
OMIM: 140571
HGNC: 5253
Ensembl: ENSG00000080824
Pharos: P07900(Tchem)
UniProt: P07900 K9JA46
Structure
LinkDB
Position
14:complement(102080742..102139749)
AA seq 732 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN
PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY
CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT
LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK
DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLE
GDDDTSRMEEVD
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaagaccaaccgatggaggaggaggaggttgagacgttc
gcctttcaggcagaaattgcccagttgatgtcattgatcatcaatactttctactcgaac
aaagagatctttctgagagagctcatttcaaattcatcagatgcattggacaaaatccgg
tatgaaagcttgacagatcccagtaaattagactctgggaaagagctgcatattaacctt
ataccgaacaaacaagatcgaactctcactattgtggatactggaattggaatgaccaag
gctgacttgatcaataaccttggtactatcgccaagtctgggaccaaagcgttcatggaa
gctttgcaggctggtgcagatatctctatgattggccagttcggtgttggtttttattct
gcttatttggttgctgagaaagtaactgtgatcaccaaacataacgatgatgagcagtac
gcttgggagtcctcagcagggggatcattcacagtgaggacagacacaggtgaacctatg
ggtcgtggaacaaaagttatcctacacctgaaagaagaccaaactgagtacttggaggaa
cgaagaataaaggagattgtgaagaaacattctcagtttattggatatcccattactctt
tttgtggagaaggaacgtgataaagaagtaagcgatgatgaggctgaagaaaaggaagac
aaagaagaagaaaaagaaaaagaagagaaagagtcggaagacaaacctgaaattgaagat
gttggttctgatgaggaagaagaaaagaaggatggtgacaagaagaagaagaagaagatt
aaggaaaagtacatcgatcaagaagagctcaacaaaacaaagcccatctggaccagaaat
cccgacgatattactaatgaggagtacggagaattctataagagcttgaccaatgactgg
gaagatcacttggcagtgaagcatttttcagttgaaggacagttggaattcagagccctt
ctatttgtcccacgacgtgctccttttgatctgtttgaaaacagaaagaaaaagaacaac
atcaaattgtatgtacgcagagttttcatcatggataactgtgaggagctaatccctgaa
tatctgaacttcattagaggggtggtagactcggaggatctccctctaaacatatcccgt
gagatgttgcaacaaagcaaaattttgaaagttatcaggaagaatttggtcaaaaaatgc
ttagaactctttactgaactggcggaagataaagagaactacaagaaattctatgagcag
ttctctaaaaacataaagcttggaatacacgaagactctcaaaatcggaagaagctttca
gagctgttaaggtactacacatctgcctctggtgatgagatggtttctctcaaggactac
tgcaccagaatgaaggagaaccagaaacatatctattatatcacaggtgagaccaaggac
caggtagctaactcagcctttgtggaacgtcttcggaaacatggcttagaagtgatctat
atgattgagcccattgatgagtactgtgtccaacagctgaaggaatttgaggggaagact
ttagtgtcagtcaccaaagaaggcctggaacttccagaggatgaagaagagaaaaagaag
caggaagagaaaaaaacaaagtttgagaacctctgcaaaatcatgaaagacatattggag
aaaaaagttgaaaaggtggttgtgtcaaaccgattggtgacatctccatgctgtattgtc
acaagcacatatggctggacagcaaacatggagagaatcatgaaagctcaagccctaaga
gacaactcaacaatgggttacatggcagcaaagaaacacctggagataaaccctgaccat
tccattattgagaccttaaggcaaaaggcagaggctgataagaacgacaagtctgtgaag
gatctggtcatcttgctttatgaaactgcgctcctgtcttctggcttcagtctggaagat
ccccagacacatgctaacaggatctacaggatgatcaaacttggtctgggtattgatgaa
gatgaccctactgctgatgataccagtgctgctgtaactgaagaaatgccaccccttgaa
ggagatgacgacacatcacgcatggaagaagtagactaa

KEGG   Homo sapiens (human): 3326
Entry
3326              CDS       T01001                                 
Symbol
HSP90AB1, D6S182, HSP84, HSP90B, HSPC2, HSPCB
Name
(RefSeq) heat shock protein 90 alpha family class B member 1
  KO
K04079  molecular chaperone HtpG
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04612  Antigen processing and presentation
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa05132  Salmonella infection
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05215  Prostate cancer
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Alvespimycin hydrochloride: D06554
Ganetespib: D10126
Luminespib (DG01842): D10646 D10647
Onalespib (DG03099): D10719 D11766
Pimitespib: D11920<JP>
Retaspimycin (DG01880): D09375 D09376
Tanespimycin: D06650
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3326 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3326 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3326 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    3326 (HSP90AB1)
   04612 Antigen processing and presentation
    3326 (HSP90AB1)
   04659 Th17 cell differentiation
    3326 (HSP90AB1)
   04657 IL-17 signaling pathway
    3326 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3326 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    3326 (HSP90AB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3326 (HSP90AB1)
   05207 Chemical carcinogenesis - receptor activation
    3326 (HSP90AB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    3326 (HSP90AB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    3326 (HSP90AB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3326 (HSP90AB1)
   05418 Fluid shear stress and atherosclerosis
    3326 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3326 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3326 (HSP90AB1)
   04131 Membrane trafficking [BR:hsa04131]
    3326 (HSP90AB1)
   03051 Proteasome [BR:hsa03051]
    3326 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3326 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3326 (HSP90AB1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3326 (HSP90AB1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP90
   3326 (HSP90AB1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    3326 (HSP90AB1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3326 (HSP90AB1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    3326 (HSP90AB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3326 (HSP90AB1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 3326
NCBI-ProteinID: NP_001258898
OMIM: 140572
HGNC: 5258
Ensembl: ENSG00000096384
Pharos: P08238(Tchem)
UniProt: P08238 A0A024RD80
Structure
LinkDB
Position
6:44246194..44253883
AA seq 724 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacttttgcctttcaggcagaa
attgcccaactcatgtccctcatcatcaataccttctattccaacaaggagattttcctt
cgggagttgatctctaatgcttctgatgccttggacaagattcgctatgagagcctgaca
gacccttcgaagttggacagtggtaaagagctgaaaattgacatcatccccaaccctcag
gaacgtaccctgactttggtagacacaggcattggcatgaccaaagctgatctcataaat
aatttgggaaccattgccaagtctggtactaaagcattcatggaggctcttcaggctggt
gcagacatctccatgattgggcagtttggtgttggcttttattctgcctacttggtggca
gagaaagtggttgtgatcacaaagcacaacgatgatgaacagtatgcttgggagtcttct
gctggaggttccttcactgtgcgtgctgaccatggtgagcccattggcaggggtaccaaa
gtgatcctccatcttaaagaagatcagacagagtacctagaagagaggcgggtcaaagaa
gtagtgaagaagcattctcagttcataggctatcccatcaccctttatttggagaaggaa
cgagagaaggaaattagtgatgatgaggcagaggaagagaaaggtgagaaagaagaggaa
gataaagatgatgaagaaaaacccaagatcgaagatgtgggttcagatgaggaggatgac
agcggtaaggataagaagaagaaaactaagaagatcaaagagaaatacattgatcaggaa
gaactaaacaagaccaagcctatttggaccagaaaccctgatgacatcacccaagaggag
tatggagaattctacaagagcctcactaatgactgggaagaccacttggcagtcaagcac
ttttctgtagaaggtcagttggaattcagggcattgctatttattcctcgtcgggctccc
tttgacctttttgagaacaagaagaaaaagaacaacatcaaactctatgtccgccgtgtg
ttcatcatggacagctgtgatgagttgataccagagtatctcaattttatccgtggtgtg
gttgactctgaggatctgcccctgaacatctcccgagaaatgctccagcagagcaaaatc
ttgaaagtcattcgcaaaaacattgttaagaagtgccttgagctcttctctgagctggca
gaagacaaggagaattacaagaaattctatgaggcattctctaaaaatctcaagcttgga
atccacgaagactccactaaccgccgccgcctgtctgagctgctgcgctatcatacctcc
cagtctggagatgagatgacatctctgtcagagtatgtttctcgcatgaaggagacacag
aagtccatctattacatcactggtgagagcaaagagcaggtggccaactcagcttttgtg
gagcgagtgcggaaacggggcttcgaggtggtatatatgaccgagcccattgacgagtac
tgtgtgcagcagctcaaggaatttgatgggaagagcctggtctcagttaccaaggagggt
ctggagctgcctgaggatgaggaggagaagaagaagatggaagagagcaaggcaaagttt
gagaacctctgcaagctcatgaaagaaatcttagataagaaggttgagaaggtgacaatc
tccaatagacttgtgtcttcaccttgctgcattgtgaccagcacctacggctggacagcc
aatatggagcggatcatgaaagcccaggcacttcgggacaactccaccatgggctatatg
atggccaaaaagcacctggagatcaaccctgaccaccccattgtggagacgctgcggcag
aaggctgaggccgacaagaatgataaggcagttaaggacctggtggtgctgctgtttgaa
accgccctgctatcttctggcttttcccttgaggatccccagacccactccaaccgcatc
tatcgcatgatcaagctaggtctaggtattgatgaagatgaagtggcagcagaggaaccc
aatgctgcagttcctgatgagatcccccctctcgagggcgatgaggatgcgtctcgcatg
gaagaagtcgattag

KEGG   Homo sapiens (human): 3329
Entry
3329              CDS       T01001                                 
Symbol
HSPD1, CPN60, GROEL, HLD4, HSP-60, HSP60, HSP65, HuCHA60, SPG13
Name
(RefSeq) heat shock protein family D (Hsp60) member 1
  KO
K04077  chaperonin GroEL
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa04940  Type I diabetes mellitus
hsa05134  Legionellosis
hsa05152  Tuberculosis
hsa05417  Lipid and atherosclerosis
Disease
H00266  Hereditary spastic paraplegia
H00679  Hypomyelinating leukodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    3329 (HSPD1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    3329 (HSPD1)
   05152 Tuberculosis
    3329 (HSPD1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3329 (HSPD1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3329 (HSPD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    3329 (HSPD1)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3329 (HSPD1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3329 (HSPD1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3329 (HSPD1)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     3329 (HSPD1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   3329 (HSPD1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    3329 (HSPD1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3329 (HSPD1)
  Exosomal proteins of other body fluids (saliva and urine)
   3329 (HSPD1)
  Exosomal proteins of breast cancer cells
   3329 (HSPD1)
  Exosomal proteins of colorectal cancer cells
   3329 (HSPD1)
  Exosomal proteins of bladder cancer cells
   3329 (HSPD1)
SSDB
Motif
Pfam: Cpn60_TCP1 EAD9
Other DBs
NCBI-GeneID: 3329
NCBI-ProteinID: NP_002147
OMIM: 118190
HGNC: 5261
Ensembl: ENSG00000144381
Pharos: P10809(Tbio)
UniProt: P10809 A0A024R3X4
Structure
LinkDB
Position
2:complement(197486584..197500274)
AA seq 573 aa
MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR
TVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDK
EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ
DAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKG
KGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIA
KNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT
TAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgcttcggttacccacagtctttcgccagatgagaccggtgtccagggtactggctcct
catctcactcgggcttatgccaaagatgtaaaatttggtgcagatgcccgagccttaatg
cttcaaggtgtagaccttttagccgatgctgtggccgttacaatggggccaaagggaaga
acagtgattattgagcagagttggggaagtcccaaagtaacaaaagatggtgtgactgtt
gcaaagtcaattgacttaaaagataaatacaaaaacattggagctaaacttgttcaagat
gttgccaataacacaaatgaagaagctggggatggcactaccactgctactgtactggca
cgctctatagccaaggaaggcttcgagaagattagcaaaggtgctaatccagtggaaatc
aggagaggtgtgatgttagctgttgatgctgtaattgctgaacttaaaaagcagtctaaa
cctgtgaccacccctgaagaaattgcacaggttgctacgatttctgcaaacggagacaaa
gaaattggcaatatcatctctgatgcaatgaaaaaagttggaagaaagggtgtcatcaca
gtaaaggatggaaaaacactgaatgatgaattagaaattattgaaggcatgaagtttgat
cgaggctatatttctccatactttattaatacatcaaaaggtcagaaatgtgaattccag
gatgcctatgttctgttgagtgaaaagaaaatttctagtatccagtccattgtacctgct
cttgaaattgccaatgctcaccgtaagcctttggtcataatcgctgaagatgttgatgga
gaagctctaagtacactcgtcttgaataggctaaaggttggtcttcaggttgtggcagtc
aaggctccagggtttggtgacaatagaaagaaccagcttaaagatatggctattgctact
ggtggtgcagtgtttggagaagagggattgaccctgaatcttgaagacgttcagcctcat
gacttaggaaaagttggagaggtcattgtgaccaaagacgatgccatgctcttaaaagga
aaaggtgacaaggctcaaattgaaaaacgtattcaagaaatcattgagcagttagatgtc
acaactagtgaatatgaaaaggaaaaactgaatgaacggcttgcaaaactttcagatgga
gtggctgtgctgaaggttggtgggacaagtgatgttgaagtgaatgaaaagaaagacaga
gttacagatgcccttaatgctacaagagctgctgttgaagaaggcattgttttgggaggg
ggttgtgccctccttcgatgcattccagccttggactcattgactccagctaatgaagat
caaaaaattggtatagaaattattaaaagaacactcaaaattccagcaatgaccattgct
aagaatgcaggtgttgaaggatctttgatagttgagaaaattatgcaaagttcctcagaa
gttggttatgatgctatggctggagattttgtgaatatggtggaaaaaggaatcattgac
ccaacaaaggttgtgagaactgctttattggatgctgctggtgtggcctctctgttaact
acagcagaagttgtagtcacagaaattcctaaagaagagaaggaccctggaatgggtgca
atgggtggaatgggaggtggtatgggaggtggcatgttctaa

DBGET integrated database retrieval system