KEGG   Homo sapiens (human): 335
Entry
335               CDS       T01001                                 
Symbol
APOA1, HPALP2, apo(a)
Name
(RefSeq) apolipoprotein A1
  KO
K08757  apolipoprotein A-I
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04975  Fat digestion and absorption
hsa04977  Vitamin digestion and absorption
hsa04979  Cholesterol metabolism
hsa05143  African trypanosomiasis
hsa05417  Lipid and atherosclerosis
Disease
H00845  Familial amyloidosis
H00930  Hypoalphalipoproteinemia
H02505  Atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    335 (APOA1)
  09154 Digestive system
   04975 Fat digestion and absorption
    335 (APOA1)
   04979 Cholesterol metabolism
    335 (APOA1)
   04977 Vitamin digestion and absorption
    335 (APOA1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    335 (APOA1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    335 (APOA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    335 (APOA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   335 (APOA1)
SSDB
Motif
Pfam: Apolipoprotein YtxH ApoLp-III Exonuc_VII_L CCDC90-like DHC_N1 DUF4455 DUF948 DUF6042 Gp58 ORC3_ins DUF2894 DUF445 Gp-FAR-1 PIN_8 FUT8_N_cat OmpH DUF4015 DHR-2_Lobe_C PnpCD_PnpD_N BshC KMP11 LMP Occludin_ELL Lant_dehydr_C TetR_C_6
Other DBs
NCBI-GeneID: 335
NCBI-ProteinID: NP_000030
OMIM: 107680
HGNC: 600
Ensembl: ENSG00000118137
Pharos: P02647(Tbio)
UniProt: P02647 A0A024R3E3
Structure
LinkDB
Position
11:complement(116835751..116837950)
AA seq 267 aa
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGS
ALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHV
DALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQ
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaaagctgcggtgctgaccttggccgtgctcttcctgacggggagccaggctcggcat
ttctggcagcaagatgaacccccccagagcccctgggatcgagtgaaggacctggccact
gtgtacgtggatgtgctcaaagacagcggcagagactatgtgtcccagtttgaaggctcc
gccttgggaaaacagctaaacctaaagctccttgacaactgggacagcgtgacctccacc
ttcagcaagctgcgcgaacagctcggccctgtgacccaggagttctgggataacctggaa
aaggagacagagggcctgaggcaggagatgagcaaggatctggaggaggtgaaggccaag
gtgcagccctacctggacgacttccagaagaagtggcaggaggagatggagctctaccgc
cagaaggtggagccgctgcgcgcagagctccaagagggcgcgcgccagaagctgcacgag
ctgcaagagaagctgagcccactgggcgaggagatgcgcgaccgcgcgcgcgcccatgtg
gacgcgctgcgcacgcatctggccccctacagcgacgagctgcgccagcgcttggccgcg
cgccttgaggctctcaaggagaacggcggcgccagactggccgagtaccacgccaaggcc
accgagcatctgagcacgctcagcgagaaggccaagcccgcgctcgaggacctccgccaa
ggcctgctgcccgtgctggagagcttcaaggtcagcttcctgagcgctctcgaggagtac
actaagaagctcaacacccagtga

DBGET integrated database retrieval system