Homo sapiens (human): 336 Help Entry 336               CDS       T01001                                  Symbol APOA2, Apo-AII, ApoA-II, apoAII Name (RefSeq) apolipoprotein A2   KO K08758   apolipoprotein A-II Organism hsa  Homo sapiens (human) Pathway hsa03320   PPAR signaling pathway hsa04979   Cholesterol metabolism Disease H00155   Familial hypercholesterolemia Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     336 (APOA2)   09154 Digestive system    04979 Cholesterol metabolism     336 (APOA2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     336 (APOA2) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of other cancer cells    336 (APOA2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ApoA-II Motif Other DBs NCBI-GeneID:  336 NCBI-ProteinID:  NP_001634 OMIM:  107670 HGNC:  601 Ensembl:  ENSG00000158874 UniProt:  P02652 LinkDB All DBs Position 1:complement(161222292..161223628) Genome browser AA seq 100 aa AA seqDB search MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaagctgctcgcagcaactgtgctactcctcaccatctgcagccttgaaggagctttg gttcggagacaggcaaaggagccatgtgtggagagcctggtttctcagtacttccagacc gtgactgactatggcaaggacctgatggagaaggtcaagagcccagagcttcaggccgag gccaagtcttactttgaaaagtcaaaggagcagctgacacccctgatcaagaaggctgga acggaactggttaacttcttgagctatttcgtggaacttggaacacagcctgccacccag tga

DBGET integrated database retrieval system