KEGG   Homo sapiens (human): 337
Entry
337               CDS       T01001                                 
Symbol
APOA4
Name
(RefSeq) apolipoprotein A4
  KO
K08760  apolipoprotein A-IV
Organism
hsa  Homo sapiens (human)
Pathway
hsa04975  Fat digestion and absorption
hsa04977  Vitamin digestion and absorption
hsa04979  Cholesterol metabolism
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    337 (APOA4)
   04979 Cholesterol metabolism
    337 (APOA4)
   04977 Vitamin digestion and absorption
    337 (APOA4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    337 (APOA4)
SSDB
Motif
Pfam: Apolipoprotein ApoLp-III Baculo_PEP_C YtxH AcaB Gp58 ApoA-II Apo-CIII BshC Carbpep_Y_N CCDC90-like DUF6376 CorA FUT8_N_cat DUF6042 Prominin DUF1848 ApoC-I PIN_8 GvpL_GvpF
Other DBs
NCBI-GeneID: 337
NCBI-ProteinID: NP_000473
OMIM: 107690
HGNC: 602
Ensembl: ENSG00000110244
UniProt: P06727
Structure
LinkDB
Position
11:complement(116820700..116823304)
AA seq 396 aa
MFLKAVVLTLALVAVAGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNA
LFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEV
SQKIGDNLRELQQRLEPYADQLRTQVSTQAEQLRRQLTPYAQRMERVLRENADSLQASLR
PHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEG
LTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQV
EEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKE
KESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgttcctgaaggccgtggtcctgaccctggccctggtggctgtcgccggagccagggct
gaggtcagtgctgaccaggtggccacggtgatgtgggactacttcagccagctgagcaac
aatgccaaggaggccgtggaacatctccagaaatctgaactcacccagcaactcaatgcc
ctcttccaggacaaacttggagaagtgaacacttacgcaggtgacctgcagaagaagctg
gtgccctttgccaccgagctgcatgaacgcctggccaaggactcggagaaactgaaggag
gagattgggaaggagctggaggagctgagggcccggctgctgccccatgccaatgaggtg
agccagaagatcggggacaacctgcgagagcttcagcagcgcctggagccctacgcggac
cagctgcgcacccaggtcagcacgcaggccgagcagctgcggcgccagctgaccccctac
gcacagcgcatggagagagtgctgcgggagaacgccgacagcctgcaggcctcgctgagg
ccccacgccgacgagctcaaggccaagatcgaccagaacgtggaggagctcaagggacgc
cttacgccctacgctgacgaattcaaagtcaagattgaccagaccgtggaggagctgcgc
cgcagcctggctccctatgctcaggacacgcaggagaagctcaaccaccagcttgagggc
ctgaccttccagatgaagaagaacgccgaggagctcaaggccaggatctcggccagtgcc
gaggagctgcggcagaggctggcgcccttggccgaggacgtgcgtggcaacctgaggggc
aacaccgaggggctgcagaagtcactggcagagctgggtgggcacctggaccagcaggtg
gaggagttccgacgccgggtggagccctacggggaaaacttcaacaaagccctggtgcag
cagatggaacagctcaggcagaaactgggcccccatgcgggggacgtggaaggccacttg
agcttcctggagaaggacctgagggacaaggtcaactccttcttcagcaccttcaaggag
aaagagagccaggacaagactctctccctccctgagctggagcaacagcaggaacagcag
caggagcagcagcaggagcaggtgcagatgctggcccctttggagagctga

DBGET integrated database retrieval system