Homo sapiens (human): 3375 Help Entry 3375              CDS       T01001                                  Symbol IAPP, DAP, IAP Name (RefSeq) islet amyloid polypeptide   KO K08039   islet amyloid polypeptide Organism hsa  Homo sapiens (human) Pathway hsa04080   Neuroactive ligand-receptor interaction hsa04081   Hormone signaling hsa04950   Maturity onset diabetes of the young Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     3375 (IAPP)    04081 Hormone signaling     3375 (IAPP)  09160 Human Diseases   09167 Endocrine and metabolic disease    04950 Maturity onset diabetes of the young     3375 (IAPP)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hsa04052]     3375 (IAPP) Cytokines and neuropeptides [BR:hsa04052]  Neuropeptides   GPCR binding    3375 (IAPP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Calc_CGRP_IAPP Motif Other DBs NCBI-GeneID:  3375 NCBI-ProteinID:  NP_000406 OMIM:  147940 HGNC:  5329 Ensembl:  ENSG00000121351 CPD:  C16130 UniProt:  P10997 Structure PDBPDBj LinkDB All DBs Position 12:21354959..21379980 Genome browser AA seq 89 aa AA seqDB search MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL SSTNVGSNTYGKRNAVEVLKREPLNYLPL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgggcatcctgaagctgcaagtatttctcattgtgctctctgttgcattgaaccatctg aaagctacacccattgaaagtcatcaggtggaaaagcggaaatgcaacactgccacatgt gcaacgcagcgcctggcaaattttttagttcattccagcaacaactttggtgccattctc tcatctaccaacgtgggatccaatacatatggcaagaggaatgcagtagaggttttaaag agagagccactgaattacttgcccctttag

DBGET integrated database retrieval system