KEGG   Homo sapiens (human): 343035
Entry
343035            CDS       T01001                                 
Symbol
RD3, C1orf36, LCA12
Name
(RefSeq) RD3 regulator of GUCY2D
  KO
K25404  protein RD3
Organism
hsa  Homo sapiens (human)
Disease
H00837  Leber congenital amaurosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    343035 (RD3)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   343035 (RD3)
SSDB
Motif
Pfam: RD3
Other DBs
NCBI-GeneID: 343035
NCBI-ProteinID: NP_001158160
OMIM: 180040
HGNC: 19689
Ensembl: ENSG00000198570
Pharos: Q7Z3Z2(Tbio)
UniProt: Q7Z3Z2
Structure
LinkDB
Position
1:complement(211476522..211492162)
AA seq 195 aa
MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDY
SWLASTPRSTYDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRS
VLQEVLERMKQEEEAHKLTRQWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPP
LRSWSMPEFRAPKAD
NT seq 588 nt   +upstreamnt  +downstreamnt
atgtctctcatctcatggcttcggtggaacgaggccccatcccggctgtccaccaggagc
cctgctgagatggtgctggagacgcttatgatggagctgacggggcagatgcgagaggct
gagaggcagcagcgggagcgcagcaatgcggtcagaaaggtctgcaccggtgtggactac
agctggctggccagcacaccccggtccacctatgacctcagccccattgagcggttgcag
ctggaagatgtctgcgttaagatccacccatcctattgtgggcctgctatcctcaggttc
cggcagctgctggcggagcaggagcccgaggtgcaggaggtgtcccagctcttccgctcg
gtgctgcaggaggtcctggagaggatgaagcaggaagaggaggcccacaagctgacgcgc
cagtggagcctgcggccccgcggcagcctggccaccttcaagacccgcgcgcgcatctcg
cccttcgccagcgacatcaggaccatctccgaggacgtggagcgggacacaccgccgcca
ctgcggtcctggagcatgcccgaattccgggcgcccaaagccgactga

DBGET integrated database retrieval system