KEGG   Homo sapiens (human): 345274
Entry
345274            CDS       T01001                                 
Symbol
SLC10A6, SOAT
Name
(RefSeq) solute carrier family 10 member 6
  KO
K14346  solute carrier family 10 (sodium/bile acid cotransporter), member 6
Organism
hsa  Homo sapiens (human)
Drug target
Maralixibat (DG02832): D10951
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    345274 (SLC10A6)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC10: Sodium bile salt cotransporter
   345274 (SLC10A6)
SSDB
Motif
Pfam: SBF
Other DBs
NCBI-GeneID: 345274
NCBI-ProteinID: NP_932069
OMIM: 613366
HGNC: 30603
Ensembl: ENSG00000145283
Pharos: Q3KNW5(Tdark)
UniProt: Q3KNW5
LinkDB
Position
4:complement(86823468..86849384)
AA seq 377 aa
MRANCSSSSACPANSSEEELPVGLEVHGNLELVFTVVSTVMMGLLMFSLGCSVEIRKLWS
HIRRPWGIAVGLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVD
GDMDLSISMTTCSTVAALGMMPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGV
YVNYRWPKQSKIILKIGAVVGGVLLLVVAVAGVVLAKGSWNSDITLLTISFIFPLIGHVT
GFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLSFTAEHLVQMLSFPLAYGLFQLID
GFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGP
MDCHRALEPVGHITSCE
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgagagccaattgttccagcagctcagcctgccctgccaacagttcagaggaggagctg
ccagtgggactggaggtgcatggaaacctggagctcgttttcacagtggtgtccactgtg
atgatggggctgctcatgttctctttgggatgttccgtggagatccggaagctgtggtcg
cacatcaggagaccctggggcattgctgtgggactgctctgccagtttgggctcatgcct
tttacagcttatctcctggccattagcttttctctgaagccagtccaagctattgctgtt
ctcatcatgggctgctgcccggggggcaccatctctaacattttcaccttctgggttgat
ggagatatggatctcagcatcagtatgacaacctgttccaccgtggccgccctgggaatg
atgccactctgcatttatctctacacctggtcctggagtcttcagcagaatctcaccatt
ccttatcagaacataggaattacccttgtgtgcctgaccattcctgtggcctttggtgtc
tatgtgaattacagatggccaaaacaatccaaaatcattctcaagattggggccgttgtt
ggtggggtcctccttctggtggtcgcagttgctggtgtggtcctggcgaaaggatcttgg
aattcagacatcacccttctgaccatcagtttcatctttcctttgattggccatgtcacg
ggttttctgctggcactttttacccaccagtcttggcaaaggtgcaggacaatttcctta
gaaactggagctcagaatattcagatgtgcatcaccatgctccagttatctttcactgct
gagcacttggtccagatgttgagtttcccactggcctatggactcttccagctgatagat
ggatttcttattgttgcagcatatcagacgtacaagaggagattgaagaacaaacatgga
aaaaagaactcaggttgcacagaagtctgccatacgaggaaatcgacttcttccagagag
accaatgccttcttggaggtgaatgaagaaggtgccatcactcctgggccaccagggcca
atggattgccacagggctctcgagccagttggccacatcacttcatgtgaatag

DBGET integrated database retrieval system