Homo sapiens (human): 345456 Help Entry 345456            CDS       T01001                                  Symbol PFN3, profilin-3 Name (RefSeq) profilin 3   KO K05759   profilin Organism hsa  Homo sapiens (human) Pathway hsa04015   Rap1 signaling pathway hsa04810   Regulation of actin cytoskeleton hsa05014   Amyotrophic lateral sclerosis hsa05131   Shigellosis hsa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     345456 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     345456 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     345456 (PFN3)    05131 Shigellosis     345456 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     345456 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     345456 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     345456 (PFN3)    04147 Exosome [BR:hsa04147]     345456 (PFN3) Membrane trafficking [BR:hsa04131]  Others   Actin-binding proteins    Others     345456 (PFN3) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      345456 (PFN3) Exosome [BR:hsa04147]  Exosomal proteins   Proteins found in most exosomes    345456 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  345456 NCBI-ProteinID:  NP_001025057 OMIM:  612812 HGNC:  18627 Ensembl:  ENSG00000196570 UniProt:  P60673 LinkDB All DBs Position 5:complement(177400109..177400661) Genome browser AA seq 137 aa AA seqDB search MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI LNKTVHELIRGLRMQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaggtctacatcagtgcagtgctgcgggaccagcgcatcgacgacgtg gccatcgtgggccatgcggacaacagctgcgtgtgggcttcgcggcccgggggcctgctg gcggccatctcgccgcaggaggtgggcgtgctcacggggccggacaggcacaccttcctg caggcgggcctgagcgtggggggccgccgctgctgcgtcatccgcgaccacctgctggcc gagggtgacggcgtgctggacgcacgcaccaaggggctggacgcgcgcgccgtgtgcgtg ggccgtgcgccgcgcgcgctcctggtgctaatgggccgacgcggcgtacatgggggcatc ctcaacaagacggtgcacgaactcatacgcgggctgcgcatgcagggcgcctag

DBGET integrated database retrieval system