Homo sapiens (human): 345456 Help Entry 345456            CDS       T01001                                  Symbol PFN3, profilin-3 Name (RefSeq) profilin 3   KO K05759   profilin Organism hsa  Homo sapiens (human) Pathway hsa04015   Rap1 signaling pathway hsa04810   Regulation of actin cytoskeleton hsa05014   Amyotrophic lateral sclerosis hsa05131   Shigellosis hsa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     345456 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     345456 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     345456 (PFN3)    05131 Shigellosis     345456 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     345456 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     345456 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     345456 (PFN3)    04147 Exosome [BR:hsa04147]     345456 (PFN3) Membrane trafficking [BR:hsa04131]  Others   Actin-binding proteins    Others     345456 (PFN3) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      345456 (PFN3) Exosome [BR:hsa04147]  Exosomal proteins   Proteins found in most exosomes    345456 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  345456 NCBI-ProteinID:  NP_001025057 OMIM:  612812 HGNC:  18627 Ensembl:  ENSG00000196570 UniProt:  P60673 LinkDB All DBs Position 5:complement(177400109..177400661) Genome browser AA seq 137 aa AA seqDB search MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI LNKTVHELIRGLRMQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaggtctacatcagtgcagtgctgcgggaccagcgcatcgacgacgtg gccatcgtgggccatgcggacaacagctgcgtgtgggcttcgcggcccgggggcctgctg gcggccatctcgccgcaggaggtgggcgtgctcacggggccggacaggcacaccttcctg caggcgggcctgagcgtggggggccgccgctgctgcgtcatccgcgaccacctgctggcc gagggtgacggcgtgctggacgcacgcaccaaggggctggacgcgcgcgccgtgtgcgtg ggccgtgcgccgcgcgcgctcctggtgctaatgggccgacgcggcgtacatgggggcatc ctcaacaagacggtgcacgaactcatacgcgggctgcgcatgcagggcgcctag

Homo sapiens (human): 375189 Help Entry 375189            CDS       T01001                                  Symbol PFN4 Name (RefSeq) profilin family member 4   KO K05759   profilin Organism hsa  Homo sapiens (human) Pathway hsa04015   Rap1 signaling pathway hsa04810   Regulation of actin cytoskeleton hsa05014   Amyotrophic lateral sclerosis hsa05131   Shigellosis hsa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     375189 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     375189 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     375189 (PFN4)    05131 Shigellosis     375189 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     375189 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     375189 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     375189 (PFN4)    04147 Exosome [BR:hsa04147]     375189 (PFN4) Membrane trafficking [BR:hsa04131]  Others   Actin-binding proteins    Others     375189 (PFN4) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      375189 (PFN4) Exosome [BR:hsa04147]  Exosomal proteins   Proteins found in most exosomes    375189 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  375189 NCBI-ProteinID:  NP_955378 OMIM:  620046 HGNC:  31103 Ensembl:  ENSG00000176732 UniProt:  Q8NHR9 LinkDB All DBs Position 2:complement(24114809..24123491) Genome browser AA seq 129 aa AA seqDB search MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVTPSDVRTLVNGFAKNPLQAR REGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSICVEATESL GDYLRKKGS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt gcagccctcatcaaaatccaggagcggagcttgtgtgtagcatcaccaggtttcaatgta acgcccagtgatgtccgaacactggtgaatggatttgccaagaaccctttgcaagcccga agagaaggactgtatttcaagggaaaagattacagatgtgtccgggcagatgaatattct ctttatgccaaaaatgagaacactggtgtggttgtcgtgaagacccatctgtatcttctg gtagcaacttacactgagggcatgtatcctagcatctgtgtggaagccacagagagcctg ggagactacctaagaaaaaaaggaagttaa

Homo sapiens (human): 5216 Help Entry 5216              CDS       T01001                                  Symbol PFN1, ALS18 Name (RefSeq) profilin 1   KO K05759   profilin Organism hsa  Homo sapiens (human) Pathway hsa04015   Rap1 signaling pathway hsa04810   Regulation of actin cytoskeleton hsa05014   Amyotrophic lateral sclerosis hsa05131   Shigellosis hsa05132   Salmonella infection Network nt06464  Amyotrophic lateral sclerosis   Element N01161   Actin polymerization N01162   Mutation-caused aberrant PFN1 to actin polymerization Disease H00058   Amyotrophic lateral sclerosis (ALS) Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     5216 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     5216 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     5216 (PFN1)    05131 Shigellosis     5216 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     5216 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     5216 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     5216 (PFN1)    04147 Exosome [BR:hsa04147]     5216 (PFN1) Membrane trafficking [BR:hsa04131]  Others   Actin-binding proteins    Others     5216 (PFN1) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      5216 (PFN1) Exosome [BR:hsa04147]  Exosomal proteins   Proteins found in most exosomes    5216 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  5216 NCBI-ProteinID:  NP_005013 OMIM:  176610 HGNC:  8881 Ensembl:  ENSG00000108518 UniProt:  P07737 Structure PDB LinkDB All DBs Position 17:complement(4945652..4948530) Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccccgggaaaacgttc gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac gtgaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag gatggggaatttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgttcccagtac tga

Homo sapiens (human): 5217 Help Entry 5217              CDS       T01001                                  Symbol PFN2, D3S1319E, PFL Name (RefSeq) profilin 2   KO K05759   profilin Organism hsa  Homo sapiens (human) Pathway hsa04015   Rap1 signaling pathway hsa04810   Regulation of actin cytoskeleton hsa05014   Amyotrophic lateral sclerosis hsa05131   Shigellosis hsa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     5217 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     5217 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     5217 (PFN2)    05131 Shigellosis     5217 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     5217 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     5217 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     5217 (PFN2)    04147 Exosome [BR:hsa04147]     5217 (PFN2) Membrane trafficking [BR:hsa04131]  Others   Actin-binding proteins    Others     5217 (PFN2) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      5217 (PFN2) Exosome [BR:hsa04147]  Exosomal proteins   Proteins found in most exosomes    5217 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  5217 NCBI-ProteinID:  NP_002619 OMIM:  176590 HGNC:  8882 Ensembl:  ENSG00000070087 UniProt:  P35080 Structure PDB LinkDB All DBs Position 3:complement(149964904..149970895) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat gtggctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg taa

DBGET integrated database retrieval system