KEGG   Homo sapiens (human): 347051
Entry
347051            CDS       T01001                                 
Symbol
SLC10A5, P5
Name
(RefSeq) solute carrier family 10 member 5
  KO
K14343  solute carrier family 10 (sodium/bile acid cotransporter), member 3/5
Organism
hsa  Homo sapiens (human)
Drug target
Maralixibat (DG02832): D10951
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    347051 (SLC10A5)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC10: Sodium bile salt cotransporter
   347051 (SLC10A5)
SSDB
Motif
Pfam: SBF
Other DBs
NCBI-GeneID: 347051
NCBI-ProteinID: NP_001010893
OMIM: 618582
HGNC: 22981
Ensembl: ENSG00000253598
Pharos: Q5PT55(Tdark)
UniProt: Q5PT55
LinkDB
Position
8:complement(81693631..81695058)
AA seq 438 aa
MIRKLFIVLLLLLVTIEEARMSSLSFLNIEKTEILFFTKTEETILVSSSYENKRPNSSHL
FVKIEDPKILQMVNVAKKISSDATNFTINLVTDEEGETNVTIQLWDSEGRQERLIEEIKN
VKVKVLKQKDSLLQAPMHIDRNILMLILPLILLNKCAFGCKIELQLFQTVWKRPLPVILG
AVTQFFLMPFCGFLLSQIVALPEAQAFGVVMTCTCPGGGGGYLFALLLDGDFTLAILMTC
TSTLLALIMMPVNSYIYSRILGLSGTFHIPVSKIVSTLLFILVPVSIGIVIKHRIPEKAS
FLERIIRPLSFILMFVGIYLTFTVGLVFLKTDNLEVILLGLLVPALGLLFGYSFAKVCTL
PLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAPFTVAMCSGCEMLLIILVYKA
KKRCIFFLQDKRKRNFLI
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgattagaaaactttttattgttctacttttgttgcttgtgactatagaagaagcaagg
atgtcatcgctcagttttctgaatatagagaagactgaaatactatttttcacaaagact
gaagaaaccatccttgtaagttcaagctacgaaaataaacggcctaattccagccacctc
tttgtgaaaatagaagatcctaaaatactacaaatggtgaatgtggccaagaagatctca
tcagatgctacaaactttaccataaatctggtgactgatgaagaaggagaaacaaatgtg
actattcaactctgggattctgaaggtaggcaagaaagactcattgaagaaatcaagaat
gtgaaagtcaaagtgctcaaacaaaaagacagtctactccaggcaccaatgcatattgat
agaaatatcctaatgcttattttaccactaatactattgaataagtgtgcatttggttgt
aagattgaattacagctgtttcaaacagtatggaagagacctttgccagtaattcttggg
gcagttacacagttttttctgatgccattttgcgggtttcttttgtctcagattgtggca
ttgcctgaggcgcaagcttttggagttgtaatgacctgcacgtgcccaggagggggtggg
ggctatctctttgctctgcttctagatggagatttcacattggccattttgatgacttgc
acatcaacattattggctctgatcatgatgcctgtcaattcttatatatacagtaggata
ttagggttgtcaggtacattccatattcctgtttctaaaattgtgtcaacactccttttc
atacttgtgccagtatcaattggaatagtcatcaagcatagaatacctgaaaaagcaagc
ttcttagagagaataattagacctctgagttttattttaatgttcgtaggaatttatttg
actttcacagtgggattagtgttcttaaaaacagataatctagaggtgattctgttgggt
ctcttagttcctgctttgggtttgctgtttgggtactcctttgctaaagtttgtacgctg
cctcttcctgtttgtaaaactgttgctattgaaagtgggatgttaaatagtttcttagct
cttgccgttattcagctgtcttttccacagtccaaggccaatttagcttctgtggctcct
tttacagtagccatgtgttctggatgtgaaatgttactgatcattctagtttacaaggct
aagaaaagatgtatctttttcttacaagataaaaggaaaagaaatttcctaatctaa

DBGET integrated database retrieval system