KEGG   Homo sapiens (human): 347148
Entry
347148            CDS       T01001                                 
Symbol
QRFP, 26RFa, P518
Name
(RefSeq) pyroglutamylated RFamide peptide
  KO
K25693  orexigenic neuropeptide QRFP
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    347148 (QRFP)
SSDB
Motif
Pfam: RFamide_26RFa
Other DBs
NCBI-GeneID: 347148
NCBI-ProteinID: NP_937823
OMIM: 609795
HGNC: 29982
Ensembl: ENSG00000188710
Pharos: P83859(Tbio)
UniProt: P83859
LinkDB
Position
9:complement(130892707..130896812)
AA seq 136 aa
MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLR
ASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELN
GYSRKKGGFSFRFGRR
NT seq 411 nt   +upstreamnt  +downstreamnt
atggtaaggccttaccccctgatctacttcctcttcctgccgctgggcgcctgcttccct
ctactggacagaagagagcccacagacgccatgggtggcctcggagctggagaacgctgg
gccgacctggccatggggccccgaccccactccgtgtggggttcctctcggtggctgaga
gcttcacagccacaggccctgcttgtcatagccagggggctgcagacatcgggcagagag
catgctggctgcagattccgcttcgggaggcaggacgaaggcagtgaggccaccggcttc
ctccctgctgcgggggagaagaccagcggcccgttagggaacctggctgaggagctcaat
ggctacagcaggaagaaaggcggcttcagcttccgcttcggtcggcggtga

DBGET integrated database retrieval system