KEGG   Homo sapiens (human): 353497
Entry
353497            CDS       T01001                                 

Gene name
POLN, POL4P
Definition
(RefSeq) DNA polymerase nu
  KO
K16618  DNA polymerase nu [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    353497 (POLN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    353497 (POLN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     353497 (POLN)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   A-family DNA polymerase
    353497 (POLN)
SSDB
Motif
Pfam: DNA_pol_A DNA_pol_P_Exo
Other DBs
NCBI-GeneID: 353497
NCBI-ProteinID: NP_861524
OMIM: 610887
HGNC: 18870
Ensembl: ENSG00000130997
Vega: OTTHUMG00000090081
Pharos: Q7Z5Q5(Tbio)
UniProt: Q7Z5Q5
LinkDB
Structure
PDB: 
4XVK 4XVI 4XVM 4XVL

Position
4p16.3
AA seq 900 aa
MENYEALVGFDLCNTPLSSVAQKIMSAMHSGDLVDSKTWGKSTETMEVINKSSVKYSVQL
EDRKTQSPEKKDLKSLRSQTSRGSAKLSPQSFSVRLTDQLSADQKQKSISSLTLSSCLIP
QYNQEASVLQKKGHKRKHFLMENINNENKGSINLKRKHITYNNLSEKTSKQMALEEDTDD
AEGYLNSGNSGALKKHFCDIRHLDDWAKSQLIEMLKQAAALVITVMYTDGSTQLGADQTP
VSSVRGIVVLVKRQAEGGHGCPDAPACGPVLEGFVSDDPCIYIQIEHSAIWDQEQEAHQQ
FARNVLFQTMKCKCPVICFNAKDFVRIVLQFFGNDGSWKHVADFIGLDPRIAAWLIDPSD
ATPSFEDLVEKYCEKSITVKVNSTYGNSSRNIVNQNVRENLKTLYRLTMDLCSKLKDYGL
WQLFRTLELPLIPILAVMESHAIQVNKEEMEKTSALLGARLKELEQEAHFVAGERFLITS
NNQLREILFGKLKLHLLSQRNSLPRTGLQKYPSTSEAVLNALRDLHPLPKIILEYRQVHK
IKSTFVDGLLACMKKGSISSTWNQTGTVTGRLSAKHPNIQGISKHPIQITTPKNFKGKED
KILTISPRAMFVSSKGHTFLAADFSQIELRILTHLSGDPELLKLFQESERDDVFSTLTSQ
WKDVPVEQVTHADREQTKKVVYAVVYGAGKERLAACLGVPIQEAAQFLESFLQKYKKIKD
FARAAIAQCHQTGCVVSIMGRRRPLPRIHAHDQQLRAQAERQAVNFVVQGSAADLCKLAM
IHVFTAVAASHTLTARLVAQIHDELLFEVEDPQIPECAALVRRTMESLEQVQALELQLQV
PLKVSLSAGRSWGHLVPLQEAWGPPPGPCRTESPSNSLAAPGSPASTQPPPLHFSPSFCL
NT seq 2703 nt   +upstreamnt  +downstreamnt
atggaaaattatgaggcattggtaggctttgatctctgtaatacaccgctctccagtgtt
gctcagaagattatgtctgctatgcattcaggtgatttagtggattctaagacttgggga
aagagtacagagactatggaagtgataaacaagtccagtgttaagtattcagtacaactt
gaagacaggaagactcaatcaccagaaaaaaaggatcttaaatctttaagaagtcagaca
tcaagaggttctgccaagctgtctcctcagtccttcagtgtcaggctcacagatcagctg
tctgctgaccaaaaacagaagagcatcagctcattgactctttcaagttgtttaattcca
cagtataatcaagaggcttcagttctacagaaaaaggggcataaaagaaagcatttccta
atggagaatataaataatgaaaataaaggaagcattaatcttaaaagaaaacatattaca
tataataatttgtcagagaaaacaagtaaacaaatggcattggaagaagatactgatgac
gccgaaggctacctaaattctgggaactcaggagcattgaaaaaacatttttgtgatatt
aggcatttggatgattgggcaaaaagccagctgattgaaatgctcaaacaggcagcagcc
ctggtgataactgtgatgtatactgatggttccacccagctaggagctgaccagaccccc
gtttcttctgttagaggaattgtggtgttagtaaaacgccaagcagagggtggccatggc
tgtccagatgccccggcctgtggtcctgttctggagggctttgtgtcagatgatccatgc
atctacattcaaatagagcactctgctatctgggaccaagaacaggaggcacatcaacaa
tttgcccggaacgtgctatttcaaacaatgaaatgtaaatgtcctgttatttgttttaat
gctaaggattttgtgagaatagtgctgcagttttttggcaatgatggcagttggaagcat
gttgctgattttatagggctagatcccagaattgctgcatggcttatagatcctagtgat
gccacaccctcttttgaagatttagtagaaaaatactgtgaaaaatccattacagttaaa
gtgaacagcacatatggaaattcctcaagaaatattgtgaatcagaatgtacgtgagaac
ctgaagacactctacagacttacaatggacctttgctctaaactgaaggattatggttta
tggcaactatttcgtactttggagcttcctctgataccaattttggcagtgatggaaagc
catgccattcaggtgaacaaagaggagatggagaagacgtcagcacttcttggggctcgt
ctcaaggaattggagcaagaagctcattttgttgcaggagaacggtttcttataacgagc
aataaccagcttcgagagatcctctttggcaagttaaagctgcacctgctgagtcaaagg
aacagtctccccagaacggggttgcagaaatacccgtctacatcagaagcagtgttaaat
gctctgcgagaccttcatccattacccaagataattttggaatacaggcaggttcacaag
atcaagtcaacctttgtagatggattactagcttgcatgaaaaagggctccatttcctct
acatggaatcagactggaactgtgactggaagactttcagccaagcatcctaatatccaa
ggtatctccaagcacccaattcagattactacacctaagaattttaaaggtaaagaagac
aagattctcacgatctccccgagggccatgtttgtttcatccaaaggccacacctttcta
gcagcagacttttcacagattgaattgcgcattcttacacatttatctggagatccggaa
cttctgaagttattccaggaatctgaaagagatgatgtattttctactctgacttcacag
tggaaggatgtgcccgtggaacaggtgacacacgcagacagagagcaaaccaagaaggtg
gtgtacgcggtggtctatggagcagggaaggagcggctggctgcttgccttggagttcct
attcaggaagctgcccagtttttggagagttttttgcagaagtacaagaaaatcaaggac
ttcgcccgagcagctattgcccagtgtcaccagacaggctgtgtggtgtccatcatgggc
agaaggagacccctgccaaggattcacgctcatgaccagcaactccgggcacaagcagag
cgacaggcagtgaacttcgtggtgcaaggctccgctgctgacctctgcaagctggccatg
atccatgtcttcactgcagtggctgcttcccacaccttgacggccaggctggtggcccag
atccatgatgagctgctgtttgaagtggaagatccgcagatcccggagtgtgcagctctc
gtcaggaggaccatggagtccttggaacaggtgcaggcattggagctgcagcttcaggta
cccctcaaggtgagcctgagtgccggccgctcatggggacacctggtgccactgcaggag
gcctggggccctccgccaggcccatgtcgcactgagtctcccagcaacagcctggctgcc
cctgggtcccctgccagcacccagcccccacccctgcatttttcgccttcattttgtctg
tag

DBGET integrated database retrieval system