KEGG   Homo sapiens (human): 3623
Entry
3623              CDS       T01001                                 
Symbol
INHA
Name
(RefSeq) inhibin subunit alpha
  KO
K05500  inhibin, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3623 (INHA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3623 (INHA)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   3623 (INHA)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 3623
NCBI-ProteinID: NP_002182
OMIM: 147380
HGNC: 6065
Ensembl: ENSG00000123999
Pharos: P05111(Tbio)
UniProt: P05111
LinkDB
Position
2:219572310..219575711
AA seq 366 aa
MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPR
RHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQH
TRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLH
LATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWP
WSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP
PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLT
QHCACI
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggtgctgcacctactgctcttcttgctgctgaccccacagggtgggcacagctgccag
gggctggagctggcccgggaacttgttctggccaaggtgagggccctgttcttggatgcc
ttggggccccccgcggtgaccagggaaggtggggaccctggagtcaggcggctgccccga
agacatgccctggggggcttcacacacaggggctctgagcccgaggaagaggaggatgtc
tcccaagccatccttttcccagccacagatgccagctgtgaggacaagtcagctgccaga
gggctggcccaggaggctgaggagggcctcttcagatacatgttccggccatcccagcat
acacgcagccgccaggtgacttcagcccagctgtggttccacaccgggctggacaggcag
ggcacagcagcctccaatagctctgagcccctgctaggcctgctggcactgtcaccggga
ggacccgtggctgtgcccatgtctttgggccatgctccccctcactgggccgtgctgcac
ctggccacctctgctctctctctgctgacccaccccgtcctggtgctgctgctgcgctgt
cccctctgtacctgctcagcccggcctgaggccacgcccttcctggtggcccacactcgg
accagaccacccagtggaggggagagagcccgacgctcaactcccctgatgtcctggcct
tggtctccctctgctctgcgcctgctgcagaggcctccggaggaaccggctgcccatgcc
aactgccacagagtagcactgaacatctccttccaggagctgggctgggaacggtggatc
gtgtaccctcccagtttcatcttccactactgtcatggtggttgtgggctgcacatccca
ccaaacctgtcccttccagtccctggggctccccctaccccagcccagccctactccttg
ctgccaggggcccagccctgctgtgctgctctcccagggaccatgaggcccctacatgtc
cgcaccacctcggatggaggttactctttcaagtatgagacagtgcccaaccttctcacg
cagcactgtgcttgtatctaa

DBGET integrated database retrieval system