KEGG   Homo sapiens (human): 3624
Entry
3624              CDS       T01001                                 
Symbol
INHBA, EDF, FRP
Name
(RefSeq) inhibin subunit beta A
  KO
K04667  inhibin beta A chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Network
nt06507  TGFB signaling
  Element
N01456  Activin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    3624 (INHBA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3624 (INHBA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3624 (INHBA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3624 (INHBA)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   3624 (INHBA)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 3624
NCBI-ProteinID: NP_002183
OMIM: 147290
HGNC: 6066
Ensembl: ENSG00000122641
Pharos: P08476(Tbio)
CPD: C18208 C17813
UniProt: P08476 A4D1W7
Structure
LinkDB
Position
7:complement(41685114..41705406)
AA seq 426 aa
MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKK
HILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQT
SEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQK
HPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDV
RIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQS
EDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAG
TSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV
EECGCS
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgcccttgctttggctgagaggatttctgttggcaagttgctggattatagtgaggagt
tcccccaccccaggatccgaggggcacagcgcggcccccgactgtccgtcctgtgcgctg
gccgccctcccaaaggatgtacccaactctcagccagagatggtggaggccgtcaagaag
cacattttaaacatgctgcacttgaagaagagacccgatgtcacccagccggtacccaag
gcggcgcttctgaacgcgatcagaaagcttcatgtgggcaaagtcggggagaacgggtat
gtggagatagaggatgacattggaaggagggcagaaatgaatgaacttatggagcagacc
tcggagatcatcacgtttgccgagtcaggaacagccaggaagacgctgcacttcgagatt
tccaaggaaggcagtgacctgtcagtggtggagcgtgcagaagtctggctcttcctaaaa
gtccccaaggccaacaggaccaggaccaaagtcaccatccgcctcttccagcagcagaag
cacccgcagggcagcttggacacaggggaagaggccgaggaagtgggcttaaagggggag
aggagtgaactgttgctctctgaaaaagtagtagacgctcggaagagcacctggcatgtc
ttccctgtctccagcagcatccagcggttgctggaccagggcaagagctccctggacgtt
cggattgcctgtgagcagtgccaggagagtggcgccagcttggttctcctgggcaagaag
aagaagaaagaagaggagggggaagggaaaaagaagggcggaggtgaaggtggggcagga
gcagatgaggaaaaggagcagtcgcacagacctttcctcatgctgcaggcccggcagtct
gaagaccaccctcatcgccggcgtcggcggggcttggagtgtgatggcaaggtcaacatc
tgctgtaagaaacagttctttgtcagtttcaaggacatcggctggaatgactggatcatt
gctccctctggctatcatgccaactactgcgagggtgagtgcccgagccatatagcaggc
acgtccgggtcctcactgtccttccactcaacagtcatcaaccactaccgcatgcggggc
catagcccctttgccaacctcaaatcgtgctgtgtgcccaccaagctgagacccatgtcc
atgttgtactatgatgatggtcaaaacatcatcaaaaaggacattcagaacatgatcgtg
gaggagtgtgggtgctcatag

DBGET integrated database retrieval system