KEGG   Homo sapiens (human): 3625
Entry
3625              CDS       T01001                                 
Symbol
INHBB
Name
(RefSeq) inhibin subunit beta B
  KO
K22687  inhibin beta B chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    3625 (INHBB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3625 (INHBB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3625 (INHBB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3625 (INHBB)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   3625 (INHBB)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide US22 DUF411 TctA
Other DBs
NCBI-GeneID: 3625
NCBI-ProteinID: NP_002184
OMIM: 147390
HGNC: 6067
Ensembl: ENSG00000163083
Pharos: P09529(Tbio)
CPD: C18208 C18209
UniProt: P09529
LinkDB
Position
2:120346136..120351803
AA seq 407 aa
MDGLPGRALGAACLLLLAAGWLGPEAWGSPTPPPTPAAPPPPPPPGSPGGSQDTCTSCGG
FRRPEELGRVDGDFLEAVKRHILSRLQMRGRPNITHAVPKAAMVTALRKLHAGKVREDGR
VEIPHLDGHASPGADGQERVSEIISFAETDGLASSRVRLYFFISNEGNQNLFVVQASLWL
YLKLLPYVLEKGSRRKVRVKVYFQEQGHGDRWNMVEKRVDLKRSGWHTFPLTEAIQALFE
RGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQARLGDSRHRIRKRGLECDGRT
NLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRM
RGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggacgggctgcccggtcgggcgctgggggccgcctgccttctgctgctggcggccggc
tggctggggcctgaggcctggggctcacccacgcccccgccgacgcctgccgcgccgccg
ccacccccgccacccggatccccgggtggctcgcaggacacctgtacgtcgtgcggcggc
ttccggcggccagaggagctcggccgagtggacggcgacttcctggaggcggtgaagcgg
cacatcttgagccgcctgcagatgcggggccggcccaacatcacgcacgccgtgcctaag
gccgccatggtcacggccctgcgcaagctgcacgcgggcaaggtgcgcgaggacggccgc
gtggagatcccgcacctcgacggccacgccagcccgggcgccgacggccaggagcgcgtt
tccgaaatcatcagcttcgccgagacagatggcctcgcctcctcccgggtccgcctatac
ttcttcatctccaacgaaggcaaccagaacctgtttgtggtccaggccagcctgtggctt
tacctgaaactcctgccctacgtcctggagaagggcagccggcggaaggtgcgggtcaaa
gtgtacttccaggagcagggccacggtgacaggtggaacatggtggagaagagggtggac
ctcaagcgcagcggctggcataccttcccactcacggaggccatccaggccttgtttgag
cggggcgagcggcgactcaacctagacgtgcagtgtgacagctgccaggagctggccgtg
gtgccggtgttcgtggacccaggcgaagagtcgcaccggccctttgtggtggtgcaggct
cggctgggcgacagcaggcaccgcattcgcaagcgaggcctggagtgcgatggccggacc
aacctctgttgcaggcaacagttcttcattgacttccgcctcatcggctggaacgactgg
atcatagcacccaccggctactacgggaactactgtgagggcagctgcccagcctacctg
gcaggggtccccggctctgcctcctccttccacacggctgtggtgaaccagtaccgcatg
cggggtctgaaccccggcacggtgaactcctgctgcattcccaccaagctgagcaccatg
tccatgctgtacttcgatgatgagtacaacatcgtcaagcgggacgtgcccaacatgatt
gtggaggagtgcggctgcgcctga

DBGET integrated database retrieval system