KEGG   Homo sapiens (human): 3626
Entry
3626              CDS       T01001                                 
Symbol
INHBC, IHBC
Name
(RefSeq) inhibin subunit beta C
  KO
K22688  inhibin beta C chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    3626 (INHBC)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3626 (INHBC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3626 (INHBC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3626 (INHBC)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   3626 (INHBC)
SSDB
Motif
Pfam: TGF_beta Anti-TRAP
Other DBs
NCBI-GeneID: 3626
NCBI-ProteinID: NP_005529
OMIM: 601233
HGNC: 6068
Ensembl: ENSG00000175189
Pharos: P55103(Tbio)
UniProt: P55103
LinkDB
Position
12:57434784..57452062
AA seq 352 aa
MTSSLLLAFLLLAPTTVATPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQR
PTLNRPVSRAALRTALQHLHGVPQGALLEDNREQECEIISFAETGLSTINQTRLDFHFSS
DRTAGDREVQQASLMFFVQLPSNTTWTLKVRVLVLGPHNTNLTLATQYLLEVDASGWHQL
PLGPEAQAACSQGHLTLELVLEGQVAQSSVILGGAAHRPFVAARVRVGGKHQIHRRGIDC
QGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLN
LLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgacctcctcattgcttctggcctttctcctcctggctccaaccacagtggccactccc
agagctggcggtcagtgtccagcatgtggggggcccaccttggaactggagagccagcgg
gagctgcttcttgatctggccaagagaagcatcttggacaagctgcacctcacccagcgc
ccaacactgaaccgccctgtgtccagagctgctttgaggactgcactgcagcacctccac
ggggtcccacagggggcacttctagaggacaacagggaacaggaatgtgaaatcatcagc
tttgctgagacaggcctctccaccatcaaccagactcgtcttgattttcacttctcctct
gatagaactgctggtgacagggaggtccagcaggccagtctcatgttctttgtgcagctc
ccttccaataccacttggaccttgaaagtgagagtccttgtgctgggtccacataatacc
aacctcaccttggctactcagtacctgctggaggtggatgccagtggctggcatcaactc
cccctagggcctgaagctcaagctgcctgcagccaggggcacctgaccctggagctggta
cttgaaggccaggtagcccagagctcagtcatcctgggtggagctgcccataggcctttt
gtggcagcccgggtgagagttgggggcaaacaccagattcaccgacgaggcatcgactgc
caaggagggtccaggatgtgctgtcgacaagagttttttgtggacttccgtgagattggc
tggcacgactggatcatccagcctgagggctacgccatgaacttctgcatagggcagtgc
ccactacacatagcaggcatgcctggtattgctgcctcctttcacactgcagtgctcaat
cttctcaaggccaacacagctgcaggcaccactggagggggctcatgctgtgtacccacg
gcccggcgccccctgtctctgctctattatgacagggacagcaacattgtcaagactgac
atacctgacatggtagtagaggcctgtgggtgcagttag

DBGET integrated database retrieval system