KEGG   Homo sapiens (human): 37
Entry
37                CDS       T01001                                 
Symbol
ACADVL, ACAD6, LCACD, VLCAD
Name
(RefSeq) acyl-CoA dehydrogenase very long chain
  KO
K09479  very long chain acyl-CoA dehydrogenase [EC:1.3.8.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa04936  Alcoholic liver disease
Module
hsa_M00087  beta-Oxidation
Network
nt06020  beta-Oxidation in mitochondria
  Element
N00804  beta-Oxidation
Disease
H00392  VLCAD deficiency
H00525  Disorders of mitochondrial fatty-acid oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    37 (ACADVL)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    37 (ACADVL)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.9  very-long-chain acyl-CoA dehydrogenase
     37 (ACADVL)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-GeneID: 37
NCBI-ProteinID: NP_000009
OMIM: 609575
HGNC: 92
Ensembl: ENSG00000072778
Pharos: P49748(Tbio)
UniProt: P49748
Structure
LinkDB
Position
17:7217125..7225266
AA seq 655 aa
MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDSHPSDAL
TRKKPAKAESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPVSRFFEEVNDPA
KNDALEMVEETTWQGLKELGAFGLQVPSELGGVGLCNTQYARLVEIVGMHDLGVGITLGA
HQSIGFKGILLFGTKAQKEKYLPKLASGETVAAFCLTEPSSGSDAASIRTSAVPSPCGKY
YTLNGSKLWISNGGLADIFTVFAKTPVTDPATGAVKEKITAFVVERGFGGITHGPPEKKM
GIKASNTAEVFFDGVRVPSENVLGEVGSGFKVAMHILNNGRFGMAAALAGTMRGIIAKAV
DHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKI
FGSEAAWKVTDECIQIMGGMGFMKEPGVERVLRDLRIFRIFEGTNDILRLFVALQGCMDK
GKELSGLGSALKNPFGNAGLLLGEAGKQLRRRAGLGSGLSLSGLVHPELSRSGELAVRAL
EQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLYAMVVVLSRASRSLSEGHPTAQHEK
MLCDTWCIEAAARIREGMAALQSDPWQQELYRNFKSISKALVERGGVVTSNPLGF
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgcaggcggctcggatggccgcgagcttggggcggcagctgctgaggctcgggggcgga
agctcgcggctcacggcgctcctggggcagccccggcccggccctgcccggcggccctat
gccgggggtgccgctcagctggctctggacaagtcagattcccacccctctgacgctctg
accaggaaaaaaccggccaaggcggaatctaagtcctttgctgtgggaatgttcaaaggc
cagctcaccacagatcaggtgttcccatacccgtccgtgctcaacgaagagcagacacag
tttcttaaagagctggtggagcctgtgtcccgtttcttcgaggaagtgaacgatcccgcc
aagaatgacgctctggagatggtggaggagaccacttggcagggcctcaaggagctgggg
gcctttggtctgcaagtgcccagtgagctgggtggtgtgggcctttgcaacacccagtac
gcccgtttggtggagatcgtgggcatgcatgaccttggcgtgggcattaccctgggggcc
catcagagcatcggtttcaaaggcatcctgctctttggcacaaaggcccagaaagaaaaa
tacctccccaagctggcatctggggagactgtggccgctttctgtctaaccgagccctca
agcgggtcagatgcagcctccatccgaacctctgctgtgcccagcccctgtggaaaatac
tataccctcaatggaagcaagctttggatcagtaatgggggcctagcagacatcttcacg
gtctttgccaagacaccagttacagatccagccacaggagccgtgaaggagaagatcaca
gcttttgtggtggagaggggcttcgggggcattacccatgggccccctgagaagaagatg
ggcatcaaggcttcaaacacagcagaggtgttctttgatggagtacgggtgccatcggag
aacgtgctgggtgaggttgggagtggcttcaaggttgccatgcacatcctcaacaatgga
aggtttggcatggctgcggccctggcaggtaccatgagaggcatcattgctaaggcggta
gatcatgccactaatcgtacccagtttggggagaaaattcacaactttgggctgatccag
gagaagctggcacggatggttatgctgcagtatgtaactgagtccatggcttacatggtg
agtgctaacatggaccagggagccacggacttccagatagaggccgccatcagcaaaatc
tttggctcggaggcagcctggaaggtgacagatgaatgcatccaaatcatggggggtatg
ggcttcatgaaggaacctggagtagagcgtgtgctccgagatcttcgcatcttccggatc
tttgaggggacaaatgacattcttcggctgtttgtggctctgcagggctgtatggacaaa
ggaaaggagctctctgggcttggcagtgctctaaagaatccctttgggaatgctggcctc
ctgctaggagaggcaggcaaacagctgaggcggcgggcagggctgggcagcggcctgagt
ctcagcggacttgtccacccggagttgagtcggagtggcgagctggcagtacgggctctg
gagcagtttgccactgtggtggaggccaagctgataaaacacaagaaggggattgtcaat
gaacagtttctgctgcagcggctggcagacggggccatcgacctctatgccatggtggtg
gttctctcgagggcctcaagatccctgagtgagggccaccccacggcccagcatgagaaa
atgctctgtgacacctggtgtatcgaggctgcagctcggatccgagagggcatggccgcc
ctgcagtctgacccctggcagcaagagctctaccgcaacttcaaaagcatctccaaggcc
ttggtggagcggggtggtgtggtcaccagcaacccacttggcttctga

DBGET integrated database retrieval system