KEGG   Homo sapiens (human): 3805
Entry
3805              CDS       T01001                                 
Symbol
KIR2DL4, CD158D, G9P, KIR-103AS, KIR-2DL4, KIR103, KIR103AS
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4
  KO
K24231  killer cell immunoglobulin-like receptor 2DL4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
hsa04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3805 (KIR2DL4)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    3805 (KIR2DL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3805 (KIR2DL4)
CD molecules [BR:hsa04090]
 Proteins
  3805 (KIR2DL4)
SSDB
Motif
Pfam: ig Ig_2 Ig_3 V-set
Other DBs
NCBI-GeneID: 3805
NCBI-ProteinID: NP_002246
OMIM: 604945
HGNC: 6332
Ensembl: ENSG00000189013
Pharos: Q99706(Tbio)
UniProt: Q99706
Structure
LinkDB
Position
19:54803610..54814517
AA seq 377 aa
MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIF
TLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVT
GLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQA
DFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARH
LHAVIRYSVAIILFTILPFFLLHRWCSKKKNAAVMNQEPAGHRTVNREDSDEQDPQEVTY
AQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQALMGSSRETT
ALSQTQLASSNVPAAGI
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtccatgtcacccacggtcatcatcctggcatgtcttgggttcttcttggaccagagt
gtgtgggcacacgtgggtggtcaggacaagcccttctgctctgcctggcccagcgctgtg
gtgcctcaaggaggacacgtgactcttcggtgtcactatcgtcgtgggtttaacatcttc
acgctgtacaagaaagatggggtccctgtccctgagctctacaacagaatattctggaac
agtttcctcattagccctgtgaccccagcacacgcagggacctacagatgtcgaggtttt
cacccgcactcccccactgagtggtcggcacccagcaaccccctggtgatcatggtcaca
ggtctatatgagaaaccttcgcttacagcccggccgggccccacggttcgcgcaggagag
aacgtgaccttgtcctgcagctcccagagctcctttgacatctaccatctatccagggag
ggggaagcccatgaacttaggctccctgcagtgcccagcatcaatggaacattccaggcc
gacttccctctgggtcctgccacccacggagagacctacagatgcttcggctctttccat
ggatctccctacgagtggtcagacccgagtgacccactgcctgtttctgtcacaggaaac
ccttctagtagttggccttcacccactgaaccaagcttcaaaactggtatcgccagacac
ctgcatgctgtgattaggtactcagtggccatcatcctctttaccatccttcccttcttt
ctccttcatcgctggtgctccaaaaaaaaaaatgctgctgtaatgaaccaagagcctgcg
ggacacagaacagtgaacagggaggactctgatgaacaagaccctcaggaggtgacatac
gcacagttggatcactgcattttcacacagagaaaaatcactggcccttctcagaggagc
aagagaccctcaacagataccagcgtgtgtatagaacttccaaatgctgagcccagagcg
ttgtctcctgcccatgagcaccacagtcaggccttgatgggatcttctagggagacaaca
gccctgtctcaaacccagcttgccagctctaatgtaccagcagctggaatctga

DBGET integrated database retrieval system