KEGG   Homo sapiens (human): 3839
Entry
3839              CDS       T01001                                 
Symbol
KPNA3, IPOA4, SRP1, SRP1gamma, SRP4, hSRP1
Name
(RefSeq) karyopherin subunit alpha 3
  KO
K23583  importin subunit alpha-4/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05132  Salmonella infection
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06123  TNF signaling (viruses and bacteria)
  Element
N01118  Salmonella SpvD to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    3839 (KPNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    3839 (KPNA3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    3839 (KPNA3)
SSDB
Motif
Pfam: Arm HEAT_EZ Arm_3 IBB HEAT HEAT_2 Adaptin_N Cnd1 V-ATPase_H_N Mo25 DCB
Other DBs
NCBI-GeneID: 3839
NCBI-ProteinID: NP_002258
OMIM: 601892
HGNC: 6396
Ensembl: ENSG00000102753
Pharos: O00505(Tbio)
UniProt: O00505 A0A024RDV7
LinkDB
Position
13:complement(49699320..49792682)
AA seq 521 aa
MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDS
DVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILV
KCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWA
LGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVIVNLCRNKDPPPPMETV
QEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKV
QTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQ
VQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLL
SVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEI
IDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggccgagaaccccagcttggagaaccaccgcatcaagagcttcaagaacaagggccgc
gatgtggaaacaatgcgaagacatagaaatgaagtgacagtggaactgcggaagaacaaa
agagatgaacacttattgaaaaagagaaatgttccccaagaagaaagtctagaagattca
gatgttgatgctgattttaaagcacaaaatgtaaccctagaagctatattgcagaatgcc
acaagtgataacccagtggtccaattgagtgctgtccaggcagcaagaaaactgttatcc
agtgacagaaatccaccgattgatgacttaataaaatctgggattttaccaattctagtc
aaatgtctagaaagggatgataatccttcattacagtttgaagctgcttgggcattaact
aacatagcatcaggaacttctgcacagactcaagctgttgtgcagtctaatgcagtacct
ctttttctgagacttcttcgttcaccacatcagaatgtttgtgaacaagcagtatgggct
ttgggaaacattataggtgatggtcctcaatgtagagattatgtcatatcactgggagtt
gtcaaacctcttctgtccttcatcagtccctccatccccatcaccttccttcggaacgtc
acatgggtcattgtcaatctctgcaggaataaggatcccccgccgcctatggagacagtt
caggagattttgccagctttatgtgtcctcatataccatacagatataaacattcttgta
gacactgtttgggctctgtcatacttgacagatggaggtaatgaacagatacagatggtt
attgattcaggagttgtgccctttcttgtgccccttctgagccatcaggaagtcaaagtt
caaacagcagccctcagagcagttggcaacatagtgactggcaccgacgagcagacccag
gttgttctcaattgtgatgtcctgtcacacttcccaaatctcttatcacacccaaaagag
aagataaataaggaagcagtgtggttcctttccaacataacagcaggcaaccagcaacaa
gttcaagctgtaatagatgctggattaattcctatgataattcatcagcttgctaagggg
gactttggaacacaaaaagaagctgcttgggcaatcagcaacttaacaataagtggcaga
aaagatcaggttgagtaccttgtacagcagaatgtaataccaccgttctgtaatttactg
tcagtgaaagattctcaagtggttcaggtggttctagatggtctaaaaaacattctgata
atggccggtgatgaagcaagcacaatagctgaaataatagaggaatgtggaggtttggag
aaaattgaagttttacagcaacatgaaaatgaagacatatataaattagcatttgaaatc
atagatcagtatttctctggtgatgatattgatgaagatccctgcctcattcctgaagca
acacaaggaggtacctacaattttgatccaacagccaaccttcaaacaaaagaatttaat
ttttaa

DBGET integrated database retrieval system