Homo sapiens (human): 391769 Help Entry 391769            CDS       T01001                                  Symbol H3Y1, H3.Y, H3.Y.1 Name (RefSeq) H3.Y histone 1   KO K11253   histone H3 Organism hsa  Homo sapiens (human) Pathway hsa04613   Neutrophil extracellular trap formation hsa05034   Alcoholism hsa05131   Shigellosis hsa05202   Transcriptional misregulation in cancer hsa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     391769 (H3Y1)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     391769 (H3Y1)   09171 Infectious disease: bacterial    05131 Shigellosis     391769 (H3Y1)   09163 Immune disease    05322 Systemic lupus erythematosus     391769 (H3Y1)   09165 Substance dependence    05034 Alcoholism     391769 (H3Y1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hsa03036]     391769 (H3Y1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     391769 (H3Y1) Chromosome and associated proteins [BR:hsa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     391769 (H3Y1) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    391769 (H3Y1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF TMA7 Motif Other DBs NCBI-GeneID:  391769 NCBI-ProteinID:  NP_001342187 HGNC:  43735 Ensembl:  ENSG00000269466 UniProt:  P0DPK2 Structure PDBPDBj LinkDB All DBs Position 5:complement(17654868..17655849) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKATAWQAPRKPLATKAAGKRAPPTGGIKKPHRYKPGTLALREIRKYQKSTQ LLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTI MPRDMQLARRLRREGP NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcaccaagcagaccgcccgcaaagccaccgcctggcaggcccccaggaagccc ctggccaccaaagcagccggaaaaagggcgccgcctacaggagggatcaagaagcctcac cgctacaagcctggcaccctggcgctgcgggaaatcagaaagtaccagaagtccacgcag ctgctcctgcgcaagctgcccttccagcgcctggtgcgcgagatcgcccaggccatcagc ccggacctgcgcttccagagtgcggccattggcgccctgcaggaggccagcgaggcctac ctggtgcagctctttgaagacaccaacctgtgtgccatccatgccaggcgcgtcacaatt atgccccgagacatgcagctggcccgccgcctccgcagagagggtccttaa

DBGET integrated database retrieval system