KEGG   Homo sapiens (human): 3934
Entry
3934              CDS       T01001                                 
Symbol
LCN2, 24p3, MSFI, NGAL, p25
Name
(RefSeq) lipocalin 2
  KO
K21129  lipocalin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    3934 (LCN2)
SSDB
Motif
Pfam: Lipocalin DUF1419 Lipocalin_2
Other DBs
NCBI-GeneID: 3934
NCBI-ProteinID: NP_005555
OMIM: 600181
HGNC: 6526
Ensembl: ENSG00000148346
Pharos: P80188(Tbio)
UniProt: P80188
Structure
LinkDB
Position
9:128149453..128153453
AA seq 198 aa
MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNA
ILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSY
PGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLG
LPENHIVFPVPIDQCIDG
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcccctaggtctcctgtggctgggcctagccctgttgggggctctgcatgcccaggcc
caggactccacctcagacctgatcccagccccacctctgagcaaggtccctctgcagcag
aacttccaggacaaccaattccaggggaagtggtatgtggtaggcctggcagggaatgca
attctcagagaagacaaagacccgcaaaagatgtatgccaccatctatgagctgaaagaa
gacaagagctacaatgtcacctccgtcctgtttaggaaaaagaagtgtgactactggatc
aggacttttgttccaggttgccagcccggcgagttcacgctgggcaacattaagagttac
cctggattaacgagttacctcgtccgagtggtgagcaccaactacaaccagcatgctatg
gtgttcttcaagaaagtttctcaaaacagggagtacttcaagatcaccctctacgggaga
accaaggagctgacttcggaactaaaggagaacttcatccgcttctccaaatctctgggc
ctccctgaaaaccacatcgtcttccctgtcccaatcgaccagtgtatcgacggctga

DBGET integrated database retrieval system