KEGG   Homo sapiens (human): 3980
Entry
3980              CDS       T01001                                 
Symbol
LIG3, LIG2, LIG3alpha, MTDPS20
Name
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Network
  Element
N01431  Core NER reaction
N01437  Short patch BER
N01438  Mitochondrial BER
Disease
H01390  Mitochondrial neurogastrointestinal encephalomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    3980 (LIG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    3980 (LIG3)
Enzymes [BR:hsa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     3980 (LIG3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     3980 (LIG3)
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase Synaptonemal_3 mRNA_cap_enzyme
Other DBs
NCBI-GeneID: 3980
NCBI-ProteinID: NP_039269
OMIM: 600940
HGNC: 6600
Ensembl: ENSG00000005156
Pharos: P49916(Tbio)
UniProt: P49916
Structure
LinkDB
Position
17:34980512..35010872
AA seq 1009 aa
MSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFLRRKPVLSFQ
GSHLRSRATYLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIG
KVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQH
IADLSSKAAGTPKKKAVVQAKLTTTGQVTSPVKGASFVTSTNPRKFSGFSAKPNNSGEAP
SSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFH
GDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQ
SKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTP
VQPMLAEACKSVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAH
FKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
NDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKALDLADMITRVIQEGLEGLVLK
DVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV
VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPS
AMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFV
AFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgtctttggctttcaagatcttctttccacaaaccctccgtgcactcagccgaaaagaa
ctgtgcctattccgaaaacatcactggcgtgatgtaagacaattcagccagtggtcagaa
acagatctgcttcatggacatcccctcttcctgagaagaaagcctgttctatcattccag
ggaagccatctaagatcacgtgccacctaccttgttttcttgccagggttgcatgtggga
ctctgcagtggcccctgtgagatggctgagcaacggttctgtgtggactatgccaagcgt
ggcacagctggctgcaaaaaatgcaaggaaaagattgtgaagggcgtatgccgaattggc
aaagtggtgcccaatcccttctcagagtctgggggtgatatgaaagagtggtaccacatt
aaatgcatgtttgagaaactagagcgggcccgggccaccacaaaaaaaatcgaggacctc
acagagctggaaggctgggaagagctggaagataatgagaaggaacagataacccagcac
attgcagatctgtcttctaaggcagcaggtacaccaaagaagaaagctgttgtccaggct
aagttgacaaccactggccaggtgacttctccagtgaaaggcgcctcatttgtcaccagt
accaatccccggaaattttctggcttttcagccaagcccaacaactctggggaagccccc
tcgagccccacccctaagagaagtctgtcttcaagcaaatgtgaccccaggcataaggac
tgtctgctacgggagtttcgaaagttatgcgccatggtggccgataatcctagctacaac
acgaagacccagatcatccaggacttccttcggaaaggctcagcaggagatggtttccac
ggtgatgtgtacctaacagtgaagctgctgctgccaggagtcattaagactgtttacaac
ttgaacgataagcagattgtgaagcttttcagtcgcatttttaactgcaacccagatgat
atggcacgggacctagagcagggtgacgtgtcagagacaatcagagtcttctttgagcag
agcaagtctttccccccagctgccaagagcctccttaccatccaggaagtggatgagttc
cttctgcggctgtccaagctcaccaaggaggatgagcagcaacaggccctacaggacatt
gcctccaggtgtacagccaatgaccttaaatgcatcatcaggttgatcaaacatgatctg
aagatgaactcaggtgcaaaacatgtgttagacgcccttgaccccaatgcctatgaagcc
ttcaaagcctcgcgcaacctgcaggatgtggtggagcgggtccttcacaacgcgcaggag
gtggagaaggagccgggccagagacgagctctgagcgtccaggcctcgctgatgacacct
gtgcagcccatgttggcggaggcctgcaagtccgttgagtatgcaatgaagaaatgtccc
aatggcatgttctctgagatcaagtacgatggagagcgagtccaggtgcataagaatgga
gaccacttcagctacttcagccgcagtctcaagcccgtccttcctcacaaggtggcccac
tttaaggactacattccccaggcttttcctgggggccacagcatgatcttggattctgaa
gtgcttctgattgacaacaagacaggcaaaccactgccctttgggactctgggagtacac
aagaaagcagccttccaggatgctaatgtctgcctgtttgtttttgattgtatctacttt
aatgatgtcagcttgatggacagacctctgtgtgagcggcggaagtttcttcatgacaac
atggttgaaattccaaaccggatcatgttctcagaaatgaagcgagtcacaaaagctttg
gacttggctgacatgataacccgggtgatccaggagggattggaggggctggtgctgaag
gatgtgaagggtacatatgagcctgggaagcggcactggctgaaagtgaagaaagactat
ttgaacgagggggccatggccgacacagctgacctggtggtccttggagccttctatggg
caagggagcaaaggcggcatgatgtcaatcttcctcatgggctgctacgaccctggcagc
cagaagtggtgcacagtcaccaagtgtgcaggaggccatgatgatgccacgcttgcccgc
ctgcagaatgaactagacatggtgaagatcagcaaggaccccagcaaaatacccagctgg
ttgaaggtcaacaagatctactatcctgacttcatcgtcccagacccaaagaaagctgcc
gtgtgggagatcacaggggctgaattctccaaatcggaggctcatacagctgacgggatc
tccatccgattccctcgctgcacccgaatccgagatgataaggactggaaatctgccact
aaccttccccaactcaaggaactgtaccagttgtccaaggagaaggcagacttcactgta
gtggctggagatgaggggagctccactacagggggtagcagtgaagagaataagggtccc
tcagggtctgctgtgtcccgcaaggcccccagcaagccctcagccagtaccaagaaagca
gaagggaagctgagtaactccaacagcaaagatggcaacatgcagactgcaaagccttcc
gctatgaaggtgggggagaagctggccacaaagtcttctccagtgaaagtaggggagaag
cggaaagctgctgatgagacgctgtgccaaacaaaggtattgctggacatcttcactggg
gtgcggctttacttgccaccctccacaccagacttcagccgtctcagacgctactttgtg
gcattcgacggggacctggtacaggaatttgatatgacttcagccacgcacgtgctgggt
agcagggacaagaaccctgcggcccagcaggtctccccagagtggatttgggcatgtatc
cggaaacggagactggtagctccctgctag

DBGET integrated database retrieval system