KEGG   Homo sapiens (human): 3980
Entry
3980              CDS       T01001                                 

Gene name
LIG3, LIG2, LIG3alpha
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    3980 (LIG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    3980 (LIG3)
Enzymes [BR:hsa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     3980 (LIG3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     3980 (LIG3)
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase Synaptonemal_3 mRNA_cap_enzyme
Other DBs
NCBI-GeneID: 3980
NCBI-ProteinID: NP_039269
OMIM: 600940
HGNC: 6600
Ensembl: ENSG00000005156
Vega: OTTHUMG00000128519
Pharos: P49916(Tbio)
UniProt: P49916
LinkDB
Structure
PDB: 

Position
17q12
AA seq 1009 aa
MSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFLRRKPVLSFQ
GSHLRSRATYLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIG
KVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQH
IADLSSKAAGTPKKKAVVQAKLTTTGQVTSPVKGASFVTSTNPRKFSGFSAKPNNSGEAP
SSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFH
GDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQ
SKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTP
VQPMLAEACKSVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAH
FKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
NDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKALDLADMITRVIQEGLEGLVLK
DVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV
VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPS
AMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFV
AFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgtctttggctttcaagatcttctttccacaaaccctccgtgcactcagccgaaaagaa
ctgtgcctattccgaaaacatcactggcgtgatgtaagacaattcagccagtggtcagaa
acagatctgcttcatggacatcccctcttcctgagaagaaagcctgttctatcattccag
ggaagccatctaagatcacgtgccacctaccttgttttcttgccagggttgcatgtggga
ctctgcagtggcccctgtgagatggctgagcaacggttctgtgtggactatgccaagcgt
ggcacagctggctgcaaaaaatgcaaggaaaagattgtgaagggcgtatgccgaattggc
aaagtggtgcccaatcccttctcagagtctgggggtgatatgaaagagtggtaccacatt
aaatgcatgtttgagaaactagagcgggcccgggccaccacaaaaaaaatcgaggacctc
acagagctggaaggctgggaagagctggaagataatgagaaggaacagataacccagcac
attgcagatctgtcttctaaggcagcaggtacaccaaagaagaaagctgttgtccaggct
aagttgacaaccactggccaggtgacttctccagtgaaaggcgcctcatttgtcaccagt
accaatccccggaaattttctggcttttcagccaagcccaacaactctggggaagccccc
tcgagccccacccctaagagaagtctgtcttcaagcaaatgtgaccccaggcataaggac
tgtctgctacgggagtttcgaaagttatgcgccatggtggccgataatcctagctacaac
acgaagacccagatcatccaggacttccttcggaaaggctcagcaggagatggtttccac
ggtgatgtgtacctaacagtgaagctgctgctgccaggagtcattaagactgtttacaac
ttgaacgataagcagattgtgaagcttttcagtcgcatttttaactgcaacccagatgat
atggcacgggacctagagcagggtgacgtgtcagagacaatcagagtcttctttgagcag
agcaagtctttccccccagctgccaagagcctccttaccatccaggaagtggatgagttc
cttctgcggctgtccaagctcaccaaggaggatgagcagcaacaggccctacaggacatt
gcctccaggtgtacagccaatgaccttaaatgcatcatcaggttgatcaaacatgatctg
aagatgaactcaggtgcaaaacatgtgttagacgcccttgaccccaatgcctatgaagcc
ttcaaagcctcgcgcaacctgcaggatgtggtggagcgggtccttcacaacgcgcaggag
gtggagaaggagccgggccagagacgagctctgagcgtccaggcctcgctgatgacacct
gtgcagcccatgttggcggaggcctgcaagtccgttgagtatgcaatgaagaaatgtccc
aatggcatgttctctgagatcaagtacgatggagagcgagtccaggtgcataagaatgga
gaccacttcagctacttcagccgcagtctcaagcccgtccttcctcacaaggtggcccac
tttaaggactacattccccaggcttttcctgggggccacagcatgatcttggattctgaa
gtgcttctgattgacaacaagacaggcaaaccactgccctttgggactctgggagtacac
aagaaagcagccttccaggatgctaatgtctgcctgtttgtttttgattgtatctacttt
aatgatgtcagcttgatggacagacctctgtgtgagcggcggaagtttcttcatgacaac
atggttgaaattccaaaccggatcatgttctcagaaatgaagcgagtcacaaaagctttg
gacttggctgacatgataacccgggtgatccaggagggattggaggggctggtgctgaag
gatgtgaagggtacatatgagcctgggaagcggcactggctgaaagtgaagaaagactat
ttgaacgagggggccatggccgacacagctgacctggtggtccttggagccttctatggg
caagggagcaaaggcggcatgatgtcaatcttcctcatgggctgctacgaccctggcagc
cagaagtggtgcacagtcaccaagtgtgcaggaggccatgatgatgccacgcttgcccgc
ctgcagaatgaactagacatggtgaagatcagcaaggaccccagcaaaatacccagctgg
ttgaaggtcaacaagatctactatcctgacttcatcgtcccagacccaaagaaagctgcc
gtgtgggagatcacaggggctgaattctccaaatcggaggctcatacagctgacgggatc
tccatccgattccctcgctgcacccgaatccgagatgataaggactggaaatctgccact
aaccttccccaactcaaggaactgtaccagttgtccaaggagaaggcagacttcactgta
gtggctggagatgaggggagctccactacagggggtagcagtgaagagaataagggtccc
tcagggtctgctgtgtcccgcaaggcccccagcaagccctcagccagtaccaagaaagca
gaagggaagctgagtaactccaacagcaaagatggcaacatgcagactgcaaagccttcc
gctatgaaggtgggggagaagctggccacaaagtcttctccagtgaaagtaggggagaag
cggaaagctgctgatgagacgctgtgccaaacaaaggtattgctggacatcttcactggg
gtgcggctttacttgccaccctccacaccagacttcagccgtctcagacgctactttgtg
gcattcgacggggacctggtacaggaatttgatatgacttcagccacgcacgtgctgggt
agcagggacaagaaccctgcggcccagcaggtctccccagagtggatttgggcatgtatc
cggaaacggagactggtagctccctgctag

DBGET integrated database retrieval system