KEGG   Homo sapiens (human): 40
Entry
40                CDS       T01001                                 
Symbol
ASIC2, ACCN, ACCN1, ASIC2a, BNC1, BNaC1, MDEG, hBNaC1
Name
(RefSeq) acid sensing ion channel subunit 2
  KO
K04828  acid-sensing ion channel 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    40 (ASIC2)
   04750 Inflammatory mediator regulation of TRP channels
    40 (ASIC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    40 (ASIC2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   40 (ASIC2)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 40
NCBI-ProteinID: NP_001085
OMIM: 601784
HGNC: 99
Ensembl: ENSG00000108684
Pharos: Q16515(Tbio)
UniProt: Q16515
Structure
LinkDB
Position
17:complement(33013087..34156768)
AA seq 512 aa
MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVES
SERVSYYFSYQHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVN
LQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGH
QDFTTVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTF
EAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDFFP
VYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLAEKDSNYCLC
RTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK
KAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVS
TCDTMPNHSETISHTVNVPLQTTLGTLEEIAC
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggacctcaaggaaagccccagtgagggcagcctgcaaccttctagcatccagatcttt
gccaacacctccaccctccatggcatccgccacatcttcgtgtatgggccgctgaccatc
cggcgtgtgctgtgggcagtggccttcgtgggctctctgggcctgctgctggtggagagc
tctgagagggtgtcctactacttctcctaccagcatgtcactaaggtggacgaagtggtg
gctcaaagcctggtcttcccagctgtgaccctctgtaacctgaatggcttccggttctcc
aggctcaccaccaatgacctgtaccatgctggggagctgctggccctgctggatgtcaac
ctgcagatcccggacccccatctggctgacccctccgtgctggaggccctgcggcagaag
gccaacttcaagcactacaaacccaagcagttcagcatgctggagttcctgcaccgtgtg
ggccatgacctgaaggatatgatgctctactgcaagttcaaagggcaggagtgcggccac
caagacttcaccacagtgtttacaaaatatgggaagtgttacatgtttaactcaggcgag
gatggcaaacctctgctcaccacggtcaagggggggacaggcaacgggctggagatcatg
ctggacattcagcaggatgagtacctgcccatctggggagagacagaggaaacgacattt
gaagcaggagtgaaagttcagatccacagtcagtctgagccacctttcatccaagagctg
ggctttggggtggctccagggttccagacctttgtggccacacaggagcagaggctcaca
tacctgcccccaccgtggggtgagtgccgatcctcagagatgggcctcgacttttttcct
gtttacagcatcaccgcctgtaggattgactgtgagacccgctacattgtggaaaactgc
aactgccgcatggttcacatgccaggggatgcccctttttgtacccctgagcagcacaag
gagtgtgcagagcctgccctaggtctgttggcggaaaaggacagcaattactgtctctgc
aggacaccctgcaacctaacccgctacaacaaagagctctccatggtgaagatccccagc
aagacatcagccaagtaccttgagaagaaatttaacaaatcagaaaaatatatctcagag
aacatccttgttctggatatattttttgaagctctcaattatgagacaattgaacagaag
aaggcgtatgaagttgctgccttacttggtgatattggtggtcagatgggattgttcatt
ggtgctagtatccttacaatactagagctctttgattatatttatgagctgatcaaagag
aagctattagacctgcttggcaaagaggaggacgaagggagccacgatgagaatgtgagt
acttgtgacacaatgccaaaccactctgaaaccatcagtcacactgtgaacgtgcccctg
cagacgaccctggggaccttggaggagattgcctgctga

KEGG   Homo sapiens (human): 41
Entry
41                CDS       T01001                                 
Symbol
ASIC1, ACCN2, ASIC, BNaC2
Name
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    41 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    41 (ASIC1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   41 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 41
NCBI-ProteinID: NP_001086
OMIM: 602866
HGNC: 100
Ensembl: ENSG00000110881
Pharos: P78348(Tchem)
UniProt: P78348 A8K1U5
Structure
LinkDB
Position
12:50057596..50083622
AA seq 528 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLD
FFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEY
CVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI
EQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSA
DKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggaactgaaggccgaggaggaggaggtgggtggcgtccagccggtgagcatccaggcc
ttcgccagcagctccacactgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcactgtgggccctgtgcttcctgggctccctggctgtgctgctgtgtgtg
tgcacggagcgtgtgcagtactacttccactaccaccatgtcaccaagctcgacgaggtg
gctgcctctcagcttaccttccctgctgtcacgctgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtatcatgctggggagctgctggccctgctcaacaac
aggtatgagataccagacacacagatggcagatgaaaagcagctggagatactgcaggac
aaagccaacttccgcagcttcaaacccaaacccttcaacatgcgtgagttctacgaccga
gctgggcacgacattcgagacatgctgctctcctgccacttccggggggaggtctgcagc
gctgaagacttcaaggtggtcttcacacgctatggaaagtgctacacgttcaactcgggc
cgagatgggcggccgcggctgaagaccatgaagggtgggacgggcaatgggctggaaatc
atgctggacatccagcaggacgagtacctgcctgtgtggggggagactgacgagacgtcc
ttcgaagcaggcatcaaagtgcagatccatagtcaggatgaacctcctttcatcgaccag
ctgggctttggcgtggccccaggcttccagacctttgtggcctgccaggagcagcggctc
atctacctgcccccaccctggggcacctgcaaagctgttaccatggactcggatttggat
ttcttcgactcctacagcatcactgcctgccgcatcgactgtgagacgcgctacctggtg
gagaactgcaactgccgcatggtgcacatgccaggggatgccccatactgtactccagag
cagtacaaggagtgtgcagatcctgctctggacttcctggtggagaaggaccaggagtac
tgcgtgtgtgaaatgccttgcaacctgacccgctatggcaaagagctgtccatggtcaag
atccccagcaaagcctcagccaagtacctggccaagaagttcaacaaatctgagcaatac
ataggggagaacatcctggtgctggacattttctttgaagtcctcaactatgagaccatt
gaacagaagaaggcctatgagattgcagggctcctgggtgacatcgggggccagatgggg
ctgttcatcggggccagcatcctcacggtgctggagctctttgactacgcctacgaggtc
attaagcacaagctgtgccgacgaggaaaatgccagaaggaggccaaaaggagcagtgcg
gacaagggcgtggccctcagcctggacgacgtcaaaagacacaacccgtgcgagagcctt
cggggccaccctgccgggatgacatacgctgccaacatcctacctcaccatccggcccga
ggcacgttcgaggactttacctgctga

KEGG   Homo sapiens (human): 51802
Entry
51802             CDS       T01001                                 
Symbol
ASIC5, ACCN5, HINAC, INAC
Name
(RefSeq) acid sensing ion channel subunit family member 5
  KO
K04832  acid-sensing ion channel 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    51802 (ASIC5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    51802 (ASIC5)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   51802 (ASIC5)
SSDB
Motif
Pfam: ASC DUF6617 Ins_beta
Other DBs
NCBI-GeneID: 51802
NCBI-ProteinID: NP_059115
OMIM: 616693
HGNC: 17537
Ensembl: ENSG00000256394
Pharos: Q9NY37(Tbio)
UniProt: Q9NY37
LinkDB
Position
4:complement(155829729..155866277)
AA seq 505 aa
MEQTEKSKVYAENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKI
RRVLWLVVVLGSVSLVTWQIYIRLLNYFTWPTTTSIEVQYVEKMEFPAVTFCNLNRFQTD
AVAKFGVIFFLWHIVSKVLHLQEITANSTGSREATDFAASHQNFSIVEFIRNKGFYLNNS
TLLDCEFFGKPCSPKDFAHVFTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAF
TDNPALGFVDAGIIFVIHSPKKVPQFDGLGLLSPVGMHARVTIRQVKTVHQEYPWGECNP
NIKLQNFSSYSTSGCLKECKAQHIKKQCGCVPFLLPGYGIECDLQKYFSCVSPVLDHIEF
KDLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLNQSRKYIRENLVKIEI
NYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYLFTNFYWICIFFLL
KISEMTQWTPPPQNHLGNKNRIEEC
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggagcagacagaaaaatcaaaagtatatgctgagaacggactcttagaaaagataaag
ctttgcctttcaaagaaaccactgccatctcccactgagcgaaagaagtttgaccatgac
tttgccatctccacttcctttcatgggatacacaatattgttcagaaccggagcaaaatt
cgcagggtgctctggttggtggtggttctgggctcagtctcacttgtgacatggcagatc
tacattcgcttgctcaactacttcacatggccaaccacaacgtccattgaggttcaatat
gtggaaaagatggagttcccagctgtgacattttgtaatttgaacaggttccaaacagat
gctgtagccaaatttggtgttatttttttcttatggcacattgtatccaaagtcctccat
cttcaagaaattactgccaattccactggctctagagaggctactgattttgctgcaagt
caccaaaacttcagcattgtggaatttatcaggaacaaaggtttttatctcaacaatagc
actttgttggactgtgagttttttggaaagccatgtagcccaaaggattttgcacatgtc
ttcactgaatatggaaattgttttacttttaatcatggtgaaactctccaagcaaagaga
aaagtgagtgtctctggaagaggtttgagcttactcttcaatgtgaatcaggaggcattc
actgataacccagcccttggtttcgttgatgctgggatcatctttgttatccattcacca
aagaaggtgccacagtttgatgggttaggcttgttgtcacctgtgggaatgcacgcaagg
gtaaccatccgccaagtgaagacagttcatcaagaatacccttggggagaatgcaatcct
aacatcaagctgcagaattttagcagctacagcacttctggttgcttgaaggaatgcaaa
gcccagcacataaaaaagcaatgtggatgtgtgccttttcttcttcctggatatgggata
gaatgtgacctacaaaagtacttcagctgtgtttctcctgtacttgaccacattgaattt
aaggatttatgtacagtaggaacacataactctagctgccccgtttcttgtgaagaaata
gaatacccggccactatttcttattcctcttttccaagtcaaaaagctttgaaatatctt
tccaagaagttgaatcaaagccggaaatacatcagggagaatcttgtaaaaattgaaatt
aactatagtgacctaaactataagataacccagcagcaaaaggcggtgagtgtgtctgag
ttacttgcagatcttggtggtcagctgggtctattttgtggggccagtctgatcacgatc
atagaaattattgaatatctattcaccaatttctactggatatgcattttctttttgctg
aagatatctgaaatgacccagtggactcctccacctcagaatcatctgggaaataaaaat
aggatagaggagtgttaa

KEGG   Homo sapiens (human): 55515
Entry
55515             CDS       T01001                                 
Symbol
ASIC4, ACCN4, BNAC4
Name
(RefSeq) acid sensing ion channel subunit family member 4
  KO
K04831  acid-sensing ion channel 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    55515 (ASIC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    55515 (ASIC4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   55515 (ASIC4)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 55515
NCBI-ProteinID: NP_061144
OMIM: 606715
HGNC: 21263
Ensembl: ENSG00000072182
Pharos: Q96FT7(Tbio)
UniProt: Q96FT7
LinkDB
Position
2:219507093..219538772
AA seq 539 aa
MPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLHGLGRACGP
GPHGLRRTLWALALLTSLAAFLYQAAGLARGYLTRPHLVAMDPAAPAPVAGFPAVTLCNI
NRFRHSALSDADIFHLANLTGLPPKDRDGHRAAGLRYPEPDMVDILNRTGHQLADMLKSC
NFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSGLEIMLDIQQEEYLPIWR
ETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRAES
ELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPGNETICPPNIYIECADHTLDS
LGGGPEGPCFCPTPCNLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFF
EALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIYEVSWDRLKRVWRRP
KTPLRTSTGGISTLGLQELKEQSPCPSRGRVEGGGVSSLLPNHHHPHGPPGGLFEDFAC
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgccgatcgagattgtgtgcaaaatcaaatttgctgaggaggatgcgaaacccaaggag
aaggaggcaggggatgagcagagcctcctcggggctgttgcccctggagcagccccccga
gacctggccacctttgccagcaccagcaccctgcatggactgggccgggcctgtggccca
ggcccccacggactgcgcagaaccctgtgggcactggccctactcacctcgctggctgcc
ttcctgtaccaggcggctggcctggcccggggctacctgacccggcctcacctggtggca
atggaccccgctgccccagccccagtggcgggcttcccggctgtcaccctctgcaatatc
aaccgcttccggcattcggcactcagcgatgccgacatcttccacctggccaatctgaca
gggctgccccccaaagaccgggatgggcaccgtgcggctggcctgcgctacccagagcct
gacatggtagacatcctcaaccgcactggccaccagctcgccgacatgcttaagagctgc
aacttcagtgggcatcactgctccgccagcaacttctctgtggtctatactcgctatggg
aagtgttacaccttcaacgcggacccgcggagctcgctgcccagccgggcagggggcatg
ggcagtggcctggagatcatgctggacatccagcaggaggagtacctgcccatctggagg
gagacaaatgagacgtcgtttgaggcaggtattcgggtgcagatccacagccaggaggag
ccgccctacatccaccagctggggttcggggtgtccccaggcttccagacctttgtgtcc
tgccaggaacagcggctgacctacctgccccagccctggggcaactgccgcgcagagagt
gagctcagggagcctgagcttcagggctactcggcctacagtgtgtctgcctgccggctg
cgctgtgaaaaggaggccgtgcttcagcgctgccactgccggatggtgcacatgccaggc
aatgagaccatctgcccaccaaatatctacatcgagtgtgcagaccacacactggactcc
ctgggtgggggccctgagggcccgtgcttctgccccaccccctgcaacctgacacgctat
gggaaagagatctccatggtcaggatccccaacaggggctcagcccggtacctggcgagg
aagtacaaccgcaacgagacctacatacgggagaacttcctggtcctagatgtcttcttt
gaggccctgacctctgaagccatggagcagcgagcagcctatggcctgtcagccctgctg
ggagacctcgggggacagatgggcctgttcattggggccagcatcctcacgttgctggag
atcctcgactacatctatgaggtgtcctgggatcgactgaagcgggtatggaggcgtccc
aagacccccctgcggacctccactgggggcatctccactttggggcttcaggagctgaag
gaacagagtccctgcccgagccggggccgagtggagggtgggggggtcagcagtctgctc
cccaatcaccaccacccccacggtcccccaggaggtctctttgaagattttgcttgctag

KEGG   Homo sapiens (human): 9311
Entry
9311              CDS       T01001                                 
Symbol
ASIC3, ACCN3, DRASIC, SLNAC1, TNaC1
Name
(RefSeq) acid sensing ion channel subunit 3
  KO
K04830  acid-sensing ion channel 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    9311 (ASIC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    9311 (ASIC3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   9311 (ASIC3)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 9311
NCBI-ProteinID: NP_004760
OMIM: 611741
HGNC: 101
Ensembl: ENSG00000213199
Pharos: Q9UHC3(Tchem)
UniProt: Q9UHC3 A0A090N7X8
LinkDB
Position
7:151048292..151052756
AA seq 531 aa
MKPTSGPEEARRPASDIRVFASNCSMHGLGHVFGPGSLSLRRGMWAAAVVLSVATFLYQV
AERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRLTPNDLHWAGSALLGLDPA
EHAAFLRALGRPPAPPGFMPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIF
TRMGKCYTFNSGADGAELLTTTRGGMGNGLDIMLDVQQEEYLPVWRDNEETPFEVGIRVQ
IHSQEEPPIIDQLGLGVSPGYQTFVSCQQQQLSFLPPPWGDCSSASLNPNYEPEPSDPLG
SPSPSPSPPYTLMGCRLACETRYVARKCGCRMVYMPGDVPVCSPQQYKNCAHPAIDAMLR
KDSCACPNPCASTRYAKELSMVRIPSRAAARFLARKLNRSEAYIAENVLALDIFFEALNY
ETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYLCEVFRDKVLGYFWNRQHSQR
HSSTNLLQEGLGSHRTQVPHLSLGPRPPTPPCAVTKTLSASHRTCYLVTQL
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgaagcccacctcaggcccagaggaggcccggcggccagcctcggacatccgcgtgttc
gccagcaactgctcgatgcacgggctgggccacgtcttcgggccaggcagcctgagcctg
cgccgggggatgtgggcagcggccgtggtcctgtcagtggccaccttcctctaccaggtg
gctgagagggtgcgctactacagggagttccaccaccagactgccctggatgagcgagaa
agccaccggctcatcttcccggctgtcaccctgtgcaacatcaacccactgcgccgctcg
cgcctaacgcccaacgacctgcactgggctgggtctgcgctgctgggcctggatcccgca
gagcacgccgccttcctgcgcgccctgggccggccccctgcaccgcccggcttcatgccc
agtcccacctttgacatggcgcaactctatgcccgtgctgggcactccctggatgacatg
ctgctggactgtcgcttccgtggccaaccttgtgggcctgagaacttcaccacgatcttc
acccggatgggaaagtgctacacatttaactctggcgctgatggggcagagctgctcacc
actactaggggtggcatgggcaatgggctggacatcatgctggacgtgcagcaggaggaa
tatctacctgtgtggagggacaatgaggagaccccgtttgaggtggggatccgagtgcag
atccacagccaggaggagccgcccatcatcgatcagctgggcttgggggtgtccccgggc
taccagacctttgtttcttgccagcagcagcagctgagcttcctgccaccgccctggggc
gattgcagttcagcatctctgaaccccaactatgagccagagccctctgatcccctaggc
tcccccagccccagccccagccctccctatacccttatggggtgtcgcctggcctgcgaa
acccgctacgtggctcggaagtgcggctgccgaatggtgtacatgccaggcgacgtgcca
gtgtgcagcccccagcagtacaagaactgtgcccacccggccatagatgccatgcttcgc
aaggactcgtgcgcctgccccaacccgtgcgccagcacgcgctacgccaaggagctctcc
atggtgcggatcccgagccgcgccgccgcgcgcttcctggcccggaagctcaaccgcagc
gaggcctacatcgcggagaacgtgctggccctggacatcttctttgaggccctcaactat
gagaccgtggagcagaagaaggcctatgagatgtcagagctgcttggtgacattgggggc
cagatggggctgttcatcggggccagcctgctcaccatcctcgagatcctagactacctc
tgtgaggtgttccgagacaaggtcctgggatatttctggaaccgacagcactcccaaagg
cactccagcaccaatctgcttcaggaagggctgggcagccatcgaacccaagttccccac
ctcagcctgggccccagacctcccacccctccctgtgccgtcaccaagactctctccgcc
tcccaccgcacctgctaccttgtcacacagctctag

DBGET integrated database retrieval system