KEGG   Homo sapiens (human): 4069
Entry
4069              CDS       T01001                                 
Symbol
LYZ, LYZF1, LZM
Name
(RefSeq) lysozyme
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Disease
H00845  Familial amyloidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    4069 (LYZ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4069 (LYZ)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     4069 (LYZ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4069 (LYZ)
SSDB
Motif
Pfam: Lys SLT SLT_3 Destabilase
Other DBs
NCBI-GeneID: 4069
NCBI-ProteinID: NP_000230
OMIM: 153450
HGNC: 6740
Ensembl: ENSG00000090382
Pharos: P61626(Tbio)
UniProt: P61626 B2R4C5
Structure
LinkDB
Position
12:69348381..69354234
AA seq 148 aa
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRA
TNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRD
PQGIRAWVAWRNRCQNRDVRQYVQGCGV
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaggctctcattgttctggggcttgtcctcctttctgttacggtccagggcaaggtc
tttgaaaggtgtgagttggccagaactctgaaaagattgggaatggatggctacagggga
atcagcctagcaaactggatgtgtttggccaaatgggagagtggttacaacacacgagct
acaaactacaatgctggagacagaagcactgattatgggatatttcagatcaatagccgc
tactggtgtaatgatggcaaaaccccaggagcagttaatgcctgtcatttatcctgcagt
gctttgctgcaagataacatcgctgatgctgtagcttgtgcaaagagggttgtccgtgat
ccacaaggcattagagcatgggtggcatggagaaatcgttgtcaaaacagagatgtccgt
cagtatgttcaaggttgtggagtgtaa

DBGET integrated database retrieval system