KEGG   Homo sapiens (human): 4338
Entry
4338              CDS       T01001                                 
Symbol
MOCS2, MCBPE, MOCO1, MOCODB, MPTS
Name
(RefSeq) molybdenum cofactor synthesis 2
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
hsa04122  Sulfur relay system
Module
hsa_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Network
nt06025  Molybdenum cofactor biosynthesis
  Element
N00890  Molybdenum cofactor biosynthesis
N00891  MOCOS deficiency in molybdenum cofactor biosynthesis
N00892  GPHN deficiency in molybdenum cofactor biosynthesis
N00893  MOCS2 deficiency in molybdenum cofactor biosynthesis
Disease
H02311  Molybdenum cofactor deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4338 (MOCS2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    4338 (MOCS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     4338 (MOCS2)
SSDB
Motif
Pfam: MoaE
Other DBs
NCBI-GeneID: 4338
NCBI-ProteinID: NP_004522
OMIM: 603708
HGNC: 7193
Ensembl: ENSG00000164172
Vega: OTTHUMG00000096981
Pharos: O96007(Tbio)
UniProt: O96007 A0A024QZS1
Structure
LinkDB
Position
5:complement(53095679..53109757)
AA seq 188 aa
MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVS
QLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNK
ECFWASNS
NT seq 567 nt   +upstreamnt  +downstreamnt
atgtcgagcttggagatcagctcctcgtgcttcagcctggagacgaaattgccgttatcc
cccccattagtggaggatagtgcttttgagccatctaggaaagatatggatgaagttgaa
gagaaatctaaagatgttataaactttactgccgagaaactttcagtagatgaagtctca
cagttggtgatttctccgctctgtggtgcaatatccctatttgtagggactacaagaaat
aactttgaagggaaaaaagtcattagcttagaatatgaagcatatctacccatggcggaa
aatgaagtcagaaagatttgtagtgacattaggcagaaatggccagtcaaacacatagca
gtgttccatagacttggcttggttccagtgtcagaagcaagcataatcattgctgtgtcc
tcagcccacagagctgcatctcttgaagctgtgagctatgccattgatactttaaaagcc
aaggtgcccatatggaaaaaggaaatatacgaagagtcatcaacttggaaaggaaacaaa
gagtgcttttgggcatccaacagttaa

DBGET integrated database retrieval system