KEGG   Homo sapiens (human): 4353
Entry
4353              CDS       T01001                                 
Symbol
MPO
Name
(RefSeq) myeloperoxidase
  KO
K10789  myeloperoxidase [EC:1.11.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00983  Drug metabolism - other enzymes
hsa04145  Phagosome
hsa04613  Neutrophil extracellular trap formation
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00116  Mutation-inactivated RUNX1 to transcription
N00118  TEL-AML1 fusion to transcriptional repression
Disease
H00101  Other phagocyte defects
H02025  Myeloperoxidase deficiency
Drug target
Verdiperstat: D11684
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    4353 (MPO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4353 (MPO)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    4353 (MPO)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4353 (MPO)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    4353 (MPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4353 (MPO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     4353 (MPO)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4353 (MPO)
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 4353
NCBI-ProteinID: NP_000241
OMIM: 606989
HGNC: 7218
Ensembl: ENSG00000005381
Vega: OTTHUMG00000178922
Pharos: P05164(Tchem)
UniProt: P05164
Structure
LinkDB
Position
17:complement(58269855..58280935)
AA seq 745 aa
MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS
LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH
VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC
NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD
QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL
GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL
REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR
SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE
GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS
NSYPRDFVNCSTLPALNLASWREAS
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgggggttcccttcttctcttctctcagatgcatggtggacttaggaccttgctgggct
gggggtctcactgcagagatgaagctgcttctggccctagcagggctcctggccattctg
gccacgccccagccctctgaaggtgctgctccagctgtcctgggggaggtggacacctcg
ttggtgctgagctccatggaggaggccaagcagctggtggacaaggcctacaaggagcgg
cgggaaagcatcaagcagcggcttcgcagcggctcagccagccccatggaactcctatcc
tacttcaagcagccggtggcagccaccaggacggcggtgagggccgctgactacctgcac
gtggctctagacctgctggagaggaagctgcggtccctgtggcgaaggccattcaatgtc
actgatgtgctgacgcccgcccagctgaatgtgttgtccaagtcaagcggctgcgcctac
caggacgtgggggtgacttgcccggagcaggacaaataccgcaccatcaccgggatgtgc
aacaacagacgcagccccacgctgggggcctccaaccgtgcctttgtgcgctggctgccg
gcggagtatgaggacggcttctctcttccctacggctggacgcccggggtcaagcgcaac
ggcttcccggtggctctggctcgcgcggtctccaacgagatcgtgcgcttccccactgat
cagctgactccggaccaggagcgctcactcatgttcatgcaatggggccagctgttggac
cacgacctcgacttcacccctgagccggccgcccgggcctccttcgtcactggcgtcaac
tgcgagaccagctgcgttcagcagccgccctgcttcccgctcaagatcccgcccaatgac
ccccgcatcaagaaccaagccgactgcatcccgttcttccgctcctgcccggcttgcccc
gggagcaacatcaccatccgcaaccagatcaacgcgctcacttccttcgtggacgccagc
atggtgtacggcagcgaggagcccctggccaggaacctgcgcaacatgtccaaccagctg
gggctgctggccgtcaaccagcgcttccaagacaacggccgggccctgctgccctttgac
aacctgcacgatgacccctgtctcctcaccaaccgctcagcgcgcatcccctgcttcctg
gcaggggacacccgttccagtgagatgcccgagctcacctccatgcacaccctcttactt
cgggagcacaaccggctggccacagagctcaagagcctgaaccctaggtgggatggggag
aggctctaccaggaagcccggaagatcgtgggggccatggtccagatcatcacttaccgg
gactacctgcccctggtgctggggccaacggccatgaggaagtacctgcccacgtaccgt
tcctacaatgactcagtggacccacgcatcgccaacgtcttcaccaatgccttccgctac
ggccacaccctcatccaacccttcatgttccgcctggacaatcggtaccagcccatggaa
cccaacccccgtgtccccctcagcagggtcttttttgcctcctggagggtcgtgctggaa
ggtggcattgaccccatcctccggggcctcatggccacccctgccaagctgaatcgtcag
aaccaaattgcagtggatgagatccgggagcgattgtttgagcaggtcatgaggattggg
ctggacctgcctgctctgaacatgcagcgcagcagggaccacggcctcccaggatacaat
gcctggaggcgcttctgtgggctcccgcagcctgaaactgtgggccagctgggcacggtg
ctgaggaacctgaaattggcgaggaaactgatggagcagtatggcacgcccaacaacatc
gacatctggatgggcggcgtgtccgagcctctgaagcgcaaaggccgcgtgggcccactc
ctcgcctgcatcatcggtacccagttcaggaagctccgggatggtgatcggttttggtgg
gagaacgagggtgtgttcagcatgcagcagcgacaggccctggcccagatctcattgccc
cggatcatctgcgacaacacaggcatcaccaccgtgtctaagaacaacatcttcatgtcc
aactcatatccccgggactttgtcaactgcagtacacttcctgcattgaacctggcttcc
tggagggaagcctcctag

DBGET integrated database retrieval system