Homo sapiens (human): 440686 Help Entry 440686            CDS       T01001                                  Symbol H3-7, H3-2, H3.7, HIST2H3PS2, p06 Name (RefSeq) H3.7 histone (putative)   KO K11253   histone H3 Organism hsa  Homo sapiens (human) Pathway hsa04613   Neutrophil extracellular trap formation hsa05034   Alcoholism hsa05131   Shigellosis hsa05202   Transcriptional misregulation in cancer hsa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     440686 (H3-7)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     440686 (H3-7)   09171 Infectious disease: bacterial    05131 Shigellosis     440686 (H3-7)   09163 Immune disease    05322 Systemic lupus erythematosus     440686 (H3-7)   09165 Substance dependence    05034 Alcoholism     440686 (H3-7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hsa03036]     440686 (H3-7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     440686 (H3-7) Chromosome and associated proteins [BR:hsa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     440686 (H3-7) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    440686 (H3-7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF YebU_pre-PUA_dom CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  440686 NCBI-ProteinID:  NP_001342338 HGNC:  32060 Ensembl:  ENSG00000273213 UniProt:  Q5TEC6 Structure PDBPDBj LinkDB All DBs Position 1:complement(143902386..143905977) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQEFKTDLRFQSSAVMALQEAREAYLVGLFEDTNLCAIHAKRVTI MPKDIQLVSRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgtactaagcagactgcccgcaagtcgaccggcggcaaggccccgaggaagcag ctggctaccaaagcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac cgctaccggcccggcaccgtggctctgcgggagatccggcgctatcagaagtctacggag ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggagtttaag acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagagaggcctac ctggtggggctgttcgaagacacgaacctgtgcgccatccatgccaagcgcgtgaccatc atgcccaaggacatccagttggtcagccgcatccgcggggagcgggcctaa

DBGET integrated database retrieval system