Homo sapiens (human): 4501 Help Entry 4501              CDS       T01001                                  Symbol MT1X, MT-1l, MT1 Name (RefSeq) metallothionein 1X   KO K14739   metallothionein 1/2 Organism hsa  Homo sapiens (human) Pathway hsa04978   Mineral absorption Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     4501 (MT1X)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hsa03019]     4501 (MT1X)    03029 Mitochondrial biogenesis [BR:hsa03029]     4501 (MT1X) Messenger RNA biogenesis [BR:hsa03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      4501 (MT1X) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     4501 (MT1X) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  4501 NCBI-ProteinID:  NP_005943 OMIM:  156359 HGNC:  7405 Ensembl:  ENSG00000187193 UniProt:  P80297 A0A140VJP8 LinkDB All DBs Position 16:56682470..56684196 Genome browser AA seq 61 aa AA seqDB search MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgctcgcctgttggctcctgtgcctgtgccggctcctgcaaa tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccctgtgggc tgtgccaagtgtgcccagggctgcatctgcaaagggacgtcagacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system