KEGG   Homo sapiens (human): 4617
Entry
4617              CDS       T01001                                 
Symbol
MYF5, EORVA, bHLHc2
Name
(RefSeq) myogenic factor 5
  KO
K18484  myogenic factor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4617 (MYF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4617 (MYF5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Myogenic transcription factors
    4617 (MYF5)
SSDB
Motif
Pfam: Myf5 Basic HLH
Other DBs
NCBI-GeneID: 4617
NCBI-ProteinID: NP_005584
OMIM: 159990
HGNC: 7565
Ensembl: ENSG00000111049
Vega: OTTHUMG00000170166
Pharos: P13349(Tbio)
UniProt: P13349
LinkDB
Position
12:80716912..80719671
AA seq 255 aa
MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTG
HHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK
VEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSS
TFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQPGLPLQDLASLSPVASTDSQP
ATPGASSSRLIYHVL
NT seq 768 nt   +upstreamnt  +downstreamnt
atggacgtgatggatggctgccagttctcaccttctgagtacttctacgacggctcctgc
ataccgtcccccgagggtgaatttggggacgagtttgtgccgcgagtggctgccttcgga
gcgcacaaagcagagctgcagggctcagatgaggacgagcacgtgcgagcgcctaccggc
caccaccaggctggtcactgcctcatgtgggcctgcaaagcctgcaagaggaagtccacc
accatggatcggcggaaggcagccactatgcgcgagcggaggcgcctgaagaaggtcaac
caggctttcgaaaccctcaagaggtgtaccacgaccaaccccaaccagaggctgcccaag
gtggagatcctcaggaatgccatccgctacatcgagagcctgcaggagttgctgagagag
caggtggagaactactatagcctgccgggacagagctgctcggagcccaccagccccacc
tccaactgctctgatggcatgcccgaatgtaacagtcctgtctggtccagaaagagcagt
acttttgacagcatctactgtcctgatgtatcaaatgtatatgccacagataaaaactcc
ttatccagcttggattgcttatccaacatagtggaccggatcacctcctcagagcaacct
gggttgcctctccaggatctggcttctctctctccagttgccagcaccgattcacagcct
gcaactccaggggcttctagttccaggcttatctatcatgtgctatga

DBGET integrated database retrieval system