KEGG   Homo sapiens (human): 4783
Entry
4783              CDS       T01001                                 
Symbol
NFIL3, E4BP4, IL3BP1, NF-IL3A, NFIL3A
Name
(RefSeq) nuclear factor, interleukin 3 regulated
  KO
K09059  nuclear factor, interleukin 3 regulated
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    4783 (NFIL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4783 (NFIL3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   bZIP/PAR
    4783 (NFIL3)
SSDB
Motif
Pfam: Vert_IL3-reg_TF bZIP_2 bZIP_1 SDE2_2C
Other DBs
NCBI-GeneID: 4783
NCBI-ProteinID: NP_001276928
OMIM: 605327
HGNC: 7787
Ensembl: ENSG00000165030
Pharos: Q16649(Tbio)
UniProt: Q16649 A0A024R241
LinkDB
Position
9:complement(91409045..91483497)
AA seq 462 aa
MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEELLLSEGSVGKNKSSAC
RRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELL
SLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIK
HSPQSSLSDVSEVSSVEHTQESSVQGSCRSPENKFQIIKQEPMELESYTREPRDDRGSYT
ASIYQNYMGNSFSGYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIH
SPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEFEATQKLSSPIDMTSK
RHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKD
SGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISASDSG
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgcagctgagaaaaatgcagaccgtcaaaaaggagcaggcgtctcttgatgccagtagc
aatgtggacaagatgatggtccttaattctgctttaacggaagtgtcagaagactccaca
acaggtgaggagctgcttctcagtgaaggaagtgtggggaagaacaaatcttctgcatgt
cggaggaaacgggaattcattcctgatgaaaagaaagatgctatgtattgggaaaaaagg
cggaaaaataatgaagctgccaaaagatctcgtgagaagcgtcgactgaatgacctggtt
ttagagaacaaactaattgcactgggagaagaaaacgccactttaaaagctgagctgctt
tcactaaaattaaagtttggtttaattagctccacagcatatgctcaagagattcagaaa
ctcagtaattctacagctgtgtactttcaagattaccagacttccaaatccaatgtgagt
tcatttgtggacgagcacgaaccctcgatggtgtcaagtagttgtatttctgtcattaaa
cactctccacaaagctcgctgtccgatgtttcagaagtgtcctcagtagaacacacgcag
gagagctctgtgcagggaagctgcagaagtcctgaaaacaagttccagattatcaagcaa
gagccgatggaattagagagctacacaagggagccaagagatgaccgaggctcttacaca
gcgtccatctatcaaaactatatggggaattctttctctgggtactcacactctccccca
ctactgcaagtcaaccgatcctccagcaactccccgagaacgtcggaaactgatgatggt
gtggtaggaaagtcatctgatggagaagacgagcaacaggtccccaagggccccatccat
tctccagttgaactcaagcatgtgcatgcaactgtggttaaagttccagaagtgaattcc
tctgccttgccacacaagctccggatcaaagccaaagccatgcagatcaaagtagaagcc
tttgataatgaatttgaggccacgcaaaaactttcctcacctattgacatgacatctaaa
agacatttcgaactcgaaaagcatagtgccccaagtatggtacattcttctcttactcct
ttctcagtgcaagtgactaacattcaagattggtctctcaaatcggagcactggcatcaa
aaagaactgagtggcaaaactcagaatagtttcaaaactggagttgttgaaatgaaagac
agtggctacaaagtttctgacccagagaacttgtatttgaagcaggggatagcaaactta
tctgcagaggttgtctcactcaagagacttatagccacacaaccaatctctgcttcagac
tctgggtaa

DBGET integrated database retrieval system