KEGG   Homo sapiens (human): 4800
Entry
4800              CDS       T01001                                 

Symbol
NFYA, CBF-A, CBF-B, HAP2, NF-YA
Name
(RefSeq) nuclear transcription factor Y subunit alpha
  KO
K08064  nuclear transcription factor Y, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05017  Spinocerebellar ataxia
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    4800 (NFYA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    4800 (NFYA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    4800 (NFYA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4800 (NFYA)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    4800 (NFYA)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
NCBI-GeneID: 4800
NCBI-ProteinID: NP_002496
OMIM: 189903
HGNC: 7804
Ensembl: ENSG00000001167
Vega: OTTHUMG00000014669
Pharos: P23511(Tbio)
UniProt: P23511
LinkDB
Structure
PDB: 
6QMP 4AWL

Position
6p21.1
AA seq 347 aa
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV
QVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL
QQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMV
PGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLH
ESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagcagtatacagcaaacagcaatagttcgacagagcagattgttgtccaggcagga
cagattcagcagcagcagcagggtggtgtcactgctgtgcagttgcagactgaggcccag
gtggcatccgcctcaggccagcaagtccagaccctccaggtagtccaagggcagccatta
atggtgcaggtcagtggaggccagctaatcacatcaactggccaacccatcatggtccag
gctgtccctggtggacaaggtcaaaccatcatgcaagtacctgtttctggaacacagggt
ttgcagcaaatacagttggtcccacctggacagatccagatccagggtggacaggctgtg
caggtgcagggccagcagggccagacccagcagatcatcatccagcagccccagacggct
gtcactgctggccagactcagacacagcagcagattgctgtccagggacagcaagtggca
cagactgctgaagggcagaccatcgtctatcaaccagttaatgcagatggcaccattctc
cagcaagttacagtccctgtttcaggcatgatcactatcccagcagccagtttggcagga
gcacagattgttcaaacaggagccaataccaacacaaccagcagtgggcaagggactgtc
actgtgacactaccagtggcaggcaatgtggtcaattcaggagggatggtcatgatggtt
cctggggctggctctgtgcctgctatccaaagaatccctctacctggagcagagatgctt
gaagaagagcctctctacgtgaatgccaaacaataccaccgtattcttaagaggaggcaa
gcccgagctaaactagaggcagaagggaaaattccaaaggagagaaggaaatacctgcat
gagtctcggcaccgtcatgccatggcacggaagcgtggtgaaggtggacgatttttctct
ccaaaggaaaaggatagtccccatatgcaggatccaaaccaagccgatgaagaagcaatg
acacagatcatccgagtgtcctaa

KEGG   Homo sapiens (human): 4801
Entry
4801              CDS       T01001                                 

Symbol
NFYB, CBF-A, CBF-B, HAP3, NF-YB
Name
(RefSeq) nuclear transcription factor Y subunit beta
  KO
K08065  nuclear transcription Y subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05152  Tuberculosis
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    4801 (NFYB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4801 (NFYB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    4801 (NFYB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4801 (NFYB)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    4801 (NFYB)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone TFIID-18kDa CENP-T_C TFIID_20kDa
Other DBs
NCBI-GeneID: 4801
NCBI-ProteinID: NP_006157
OMIM: 189904
HGNC: 7805
Ensembl: ENSG00000120837
Vega: OTTHUMG00000170176
Pharos: P25208(Tbio)
UniProt: P25208 A0A024RBG7
LinkDB
Structure
PDB: 

Position
12q23.3
AA seq 207 aa
MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP
IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF
AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLIT
TDGQQQNVMVYTTSYQQISGVQQIQFS
NT seq 624 nt   +upstreamnt  +downstreamnt
atgacaatggatggtgacagttctacaacagatgcttctcaactaggaatctctgcagac
tatattggaggaagtcattatgttatacagcctcatgatgatactgaggacagcatgaat
gatcatgaagacacaaatggttcaaaagaaagtttcagagaacaagatatatatcttcca
atagcaaacgtggctaggataatgaaaaatgccatacctcaaacgggaaagattgcaaaa
gatgccaaagaatgtgttcaagaatgtgtaagtgagttcatcagttttataacatctgaa
gcaagtgaaaggtgccatcaagagaaacggaaaacaatcaatggagaagatattctcttt
gctatgtctactttaggctttgacagttatgtggaacctctgaaattataccttcagaaa
ttcagagaggctatgaaaggagaaaagggaattggtggagcagtcacagctacagatgga
ctaagtgaagagcttacagaggaggcatttactaaccagttaccagctggcttaataacc
acagacggtcaacaacaaaatgttatggtttacacaacatcatatcaacagatttctggt
gttcagcaaattcagttttcatga

KEGG   Homo sapiens (human): 4802
Entry
4802              CDS       T01001                                 

Symbol
NFYC, CBF-C, CBFC, H1TF2A, HAP5, HSM, NF-YC
Name
(RefSeq) nuclear transcription factor Y subunit gamma
  KO
K08066  nuclear transcription factor Y, gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    4802 (NFYC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    4802 (NFYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4802 (NFYC)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    4802 (NFYC)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF E1-E2_ATPase CENP-X
Other DBs
NCBI-GeneID: 4802
NCBI-ProteinID: NP_001295043
OMIM: 605344
HGNC: 7806
Ensembl: ENSG00000066136
Vega: OTTHUMG00000007729
Pharos: Q13952(Tbio)
UniProt: Q13952
LinkDB
Structure
PDB: 

Position
1p34.2
AA seq 458 aa
MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIP
VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRNASQGKPRRCLKETLQITQTE
VQQGQQQFSQFTDGQRNSVQQARVSELTGEAEPREVKATGNSTPCTSSLPTTHPPSHRAG
ASCVCCSQPQQSSTSPPPSDALQWVVVEVSGTPNQLETHRELHAPLPGMTSLSPLHPSQQ
LYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgtccacagaaggaggatttggtggtactagcagcagtgatgcccagcaaagcctacag
tcgttctggcctcgggtcatggaagaaatccggaatttaacagtgaaagacttccgagtg
caggaactcccactggctcgtattaagaagattatgaaactggatgaagatgtgaagatg
atcagtgcagaagcgcctgtactctttgccaaggcagcccagatttttatcacagagttg
actcttcgagcctggattcacacagaagataacaagcgccggactctacagagaaatgat
atcgccatggcaattacaaaatttgatcagtttgattttctcatcgatattgttccaaga
gatgaactgaaacctccaaagcgtcaggaggaggtgcgccagtctgtaactcctgccgag
ccagtccagtactatttcacgctggctcagcaacccaccgctgtccaagtccagggccag
cagcaaggccagcagaccaccagctccacgaccaccatccagcctgggcagatcatcatc
gcacagcctcagcagggccagaccacacctgtgacaatgcaggttggagaaggtcagcag
gtgcagattgtccaggctcagccacagggtcaagcccaacaggcccagagtggcactgga
cagaccatgcaggtgatgcagcagatcatcactaacacaggagagatccagcagatcccg
gtgcagctgaatgccggccagctgcagtatatccgcttagcccagcctgtatcaggcact
caagttgtgcagggacagatccagacacttgccaccaatgctcaacaggggcaaagaaat
gcaagtcaggggaagcctcgaaggtgcctgaaagaaaccttacagattacacagacagag
gtccagcaaggacagcagcagttcagccagttcacagatggacagaggaacagcgtgcag
caagctcgagtctctgagctaacgggagaggcagagcccagagaagtgaaagccacagga
aattcaactccctgcacctcttccctgcccaccacacaccccccctcacaccgggctggt
gcctcctgtgtctgctgctcccaaccccagcagagctccacttcccctcctccttctgac
gccttgcagtgggtggtggttgaggtatctgggacccccaaccagctcgagacccatagg
gagctgcatgcccctctcccagggatgacctcactctctcctctccacccctcgcagcag
ctctaccagatccagcaagtcaccatgcctgcgggccaggacctcgcccagcccatgttc
atccagtcagccaaccagccctccgacgggcaggccccccaggtgaccggcgactga

DBGET integrated database retrieval system