KEGG   Homo sapiens (human): 4821
Entry
4821              CDS       T01001                                 

Gene name
NKX2-2, NKX2.2, NKX2B
Definition
(RefSeq) NK2 homeobox 2
  KO
K08029  homeobox protein Nkx-2.2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    4821 (NKX2-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4821 (NKX2-2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    4821 (NKX2-2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 4821
NCBI-ProteinID: NP_002500
OMIM: 604612
HGNC: 7835
Ensembl: ENSG00000125820
Vega: OTTHUMG00000170524
Pharos: O95096(Tbio)
UniProt: O95096
LinkDB
Position
20p11.22
AA seq 273 aa
MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLP
LKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPG
GGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHR
YKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQ
SLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
NT seq 822 nt   +upstreamnt  +downstreamnt
atgtcgctgaccaacacaaagacggggttttcggtcaaggacatcttagacctgccggac
accaacgatgaggagggctctgtggccgaaggtccggaggaagagaacgaggggcccgag
ccagccaagagggccgggccgctggggcagggcgccctggacgcggtgcagagcctgccc
ctgaagaaccccttctacgacagcagcgacaacccgtacacgcgctggctggccagcacc
gagggccttcagtactccctgcacggtctggctgccggggcgccccctcaggactcaagc
tccaagtccccggagccctcggccgacgagtcaccggacaatgacaaggagaccccgggc
ggcgggggggacgccggcaagaagcgaaagcggcgagtgcttttctccaaggcgcagacc
tacgagctggagcggcgctttcggcagcagcggtacctgtcggcgcccgagcgcgaacac
ctggccagcctcatccgcctcacgcccacgcaggtcaagatctggttccagaaccaccgc
tacaagatgaagcgcgcccgggccgagaaaggtatggaggtgacgcccctgccctcgccg
cgccgggtggccgtgcccgtcttggtcagggacggcaaaccatgtcacgcgctcaaagcc
caggacctggcagccgccaccttccaggcgggcattcccttttctgcctacagcgcgcag
tcgctgcagcacatgcagtacaacgcccagtacagctcggccagcaccccccagtacccg
acagcacaccccctggtccaggcccagcagtggacttggtga

DBGET integrated database retrieval system