KEGG   Homo sapiens (human): 5018
Entry
5018              CDS       T01001                                 

Gene name
OXA1L, OXA1
Definition
(RefSeq) OXA1L mitochondrial inner membrane protein
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    5018 (OXA1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    5018 (OXA1L)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    5018 (OXA1L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    5018 (OXA1L)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   5018 (OXA1L)
SSDB
Motif
Pfam: 60KD_IMP
Other DBs
NCBI-GeneID: 5018
NCBI-ProteinID: NP_005006
OMIM: 601066
HGNC: 8526
Ensembl: ENSG00000155463
Vega: OTTHUMG00000028691
Pharos: Q15070(Tbio)
UniProt: Q15070 Q2M1J6 J3KNA0
LinkDB
Position
14q11.2
AA seq 435 aa
MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPAAPCCCRPHYLFLAASG
PRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAELGLGSYT
PVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFS
SRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANL
PVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELGAETGVQSSDLQWMRNVIRMM
PLITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQRVVHDLDKLPPREG
FLESFKKGWKNAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS
SSKPKSKYPWHDTLG
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggcgatgggactaatgtgcggacgccgggagcttctgcgcttgctacagtccgggcgt
cgggtccacagcgtcgcagggccctcgcaatggcttgggaaaccgctgaccacacggctc
ctattcccagcagccccgtgctgctgtcgcccacactacctcttccttgcggcttccggc
ccccgcagcctcagtacctctgctatctcttttgcagaagtccaggttcaggcccctcct
gttgttgctgcaactccctcacccacagcagtacctgaggtggcttctggagagactgca
gatgtagtccaaactgctgcagagcagagcttcgctgaactggggctggggtcatacacc
ccagtgggactgatccagaatttactggaatttatgcatgttgatctgggcctaccttgg
tggggggccattgctgcatgtacagtctttgcccgctgcctgatttttcctctcatcgtg
acgggccagcgagaggcagccaggatccacaatcacttgccagagatccagaagttttcc
agtcgaatcagagaggccaagttagcaggagaccatattgagtattacaaggcttcctcg
gagatggcactttaccagaaaaaacatggtattaaactctataaacctctcattctccct
gtgactcaggccccaatcttcatctccttcttcattgctttgagagagatggccaacctt
cctgtgcccagcctgcagacaggtggcctctggtggttccaggatctcacggtatccgat
cccatctacatattaccactggcagtcactgctacaatgtgggctgttcttgagctaggt
gctgagacaggtgtgcaaagttctgaccttcagtggatgagaaatgtcatcagaatgatg
cccctgataaccttgcccataaccatgcatttccccacggcagtgtttatgtactggctc
tcctccaatttgttttccctggtccaagtatcctgtctccggattccagcagtacgcact
gtacttaaaatcccccagcgtgttgtacatgacctggacaaattacctccacgggaaggc
ttcctagagagcttcaaaaaaggctggaaaaatgctgaaatgacgcgtcagctgcgagag
cgtgaacaacgcatgcggaatcagttggagctagcagccaggggtcctttacgacagacc
tttacccacaaccctctcctacaacctggaaaggataaccctcccaatatccctagcagc
agcagcaaaccaaagtcaaagtatccctggcacgacacacttggctga

DBGET integrated database retrieval system