KEGG   Homo sapiens (human): 50674
Entry
50674             CDS       T01001                                 

Gene name
NEUROG3, Atoh5, Math4B, NGN-3, bHLHa7, ngn3
Definition
(RefSeq) neurogenin 3
  KO
K08028  neurogenin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04950  Maturity onset diabetes of the young
Disease
H01174  Congenital diarrhea
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    50674 (NEUROG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    50674 (NEUROG3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    50674 (NEUROG3)
SSDB
Motif
Pfam: HLH Umbravirus_LDM
Other DBs
NCBI-GeneID: 50674
NCBI-ProteinID: NP_066279
OMIM: 604882
HGNC: 13806
Ensembl: ENSG00000122859
Vega: OTTHUMG00000018391
Pharos: Q9Y4Z2(Tbio)
UniProt: Q9Y4Z2
LinkDB
Position
10q22.1
AA seq 214 aa
MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRK
LRARRGGRSRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLT
KIETLRFAHNYIWALTQTLRIADHSLYALEPPAPHCGELGSPGGSPGDWGSLYSPVSQAG
SLSPAASLEERPGLLGATFSACLSPGSLAFSDFL
NT seq 645 nt   +upstreamnt  +downstreamnt
atgacgcctcaaccctcgggtgcgcccactgtccaagtgacccgtgagacggagcggtcc
ttccccagagcctcggaagacgaagtgacctgccccacgtccgccccgcccagccccact
cgcacacgggggaactgcgcagaggcggaagagggaggctgccgaggggccccgaggaag
ctccgggcacggcgcgggggacgcagccggcctaagagcgagttggcactgagcaagcag
cgacggagtcggcgaaagaaggccaacgaccgcgagcgcaatcgaatgcacaacctcaac
tcggcactggacgccctgcgcggtgtcctgcccaccttcccagacgacgcgaagctcacc
aagatcgagacgctgcgcttcgcccacaactacatctgggcgctgactcaaacgctgcgc
atagcggaccacagcttgtacgcgctggagccgccggcgccgcactgcggggagctgggc
agcccaggcggttcccccggggactgggggtccctctactccccagtctcccaggctggc
agcctgagtcccgccgcgtcgctggaggagcgacccgggctgctgggggccaccttttcc
gcctgcttgagcccaggcagtctggctttctcagattttctgtga

DBGET integrated database retrieval system