KEGG   Homo sapiens (human): 51028
Entry
51028             CDS       T01001                                 
Symbol
VPS36, C13orf9, CGI-145, EAP45
Name
(RefSeq) vacuolar protein sorting 36 homolog
  KO
K12190  ESCRT-II complex subunit VPS36
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    51028 (VPS36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51028 (VPS36)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    51028 (VPS36)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-II complex
    51028 (VPS36)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   51028 (VPS36)
  Exosomal proteins of colorectal cancer cells
   51028 (VPS36)
SSDB
Motif
Pfam: EAP30 Vps36_ESCRT-II MA3 GRAM Xre-like-HTH
Other DBs
NCBI-GeneID: 51028
NCBI-ProteinID: NP_057159
OMIM: 610903
HGNC: 20312
Ensembl: ENSG00000136100
Pharos: Q86VN1(Tbio)
UniProt: Q86VN1
Structure
LinkDB
Position
13:complement(52412606..52450634)
AA seq 386 aa
MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMA
ILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYR
RLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFED
LSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQ
YHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLP
LRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLA
EKMGHLCRDDSVEGLRFYPNLFMTQS
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggaccgcttcgtttggaccagcggcctcctggagatcaacgagaccctggtgatccag
cagcgcggggtgcgaatctacgatggcgaggagaagataaaatttgatgctgggactctc
cttcttagtacacaccgactgatttggagagatcagaaaaatcatgagtgttgcatggcc
attctcctttcccaaattgtgttcattgaagaacaggcggctggaattgggaagagtgcc
aaaatagtggttcatcttcacccagctcctcctaacaaagaacctggcccattccagagt
agtaagaactcctacatcaaactctccttcaaagaacatggccagattgagttttacagg
cgtttatcagaggaaatgacacaaagaagatgggagaatatgccagtttcccagtcatta
caaacaaatagaggaccccagccaggaagaataagggctgtaggaattgtaggtattgaa
aggaaactggaagaaaaaagaaaagaaactgacaaaaacatttctgaggcctttgaagac
ctcagcaaactaatgatcaaggctaaggaaatggtggaattatcaaaatcaattgctaat
aaaattaaagacaaacaaggtgacatcacagaagatgagaccatcaggtttaaatcctac
ttgctgagcatgggaatagctaacccagttaccagagaaacctacggctcaggcacacag
taccacatgcagctggccaaacaactggctggaatattgcaggtgcctttagaggaacga
gggggaataatgtcactcacggaggtgtactgcttagtaaaccgagctcgaggaatggaa
ttgctctcaccagaagatttagtgaatgcgtgcaagatgctggaagcactgaaattacct
ctcaggctccgtgtgtttgacagtggcgtcatggtaattgagcttcagtctcacaaggaa
gaggaaatggtggcctcggccctggagacagtttcagaaaagggatccctaacatcagaa
gagtttgctaagcttgtgggaatgtctgtcctcctagccaaagaaaggttgctgcttgca
gagaagatgggccatctttgccgtgatgactcagtggaaggcctgcgtttttacccaaat
ttatttatgacacagagctaa

DBGET integrated database retrieval system