KEGG   Homo sapiens (human): 51085Help
Entry
51085             CDS       T01001                                 

Gene name
MLXIPL, CHREBP, MIO, MLX, MONDOB, WBSCR14, WS-bHLH, bHLHd14
Definition
(RefSeq) MLX interacting protein like
  KO
K09113  MAX-like protein X
Organism
hsa  Homo sapiens (human)
Pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    51085 (MLXIPL)
   04931 Insulin resistance
    51085 (MLXIPL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    51085 (MLXIPL)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    51085 (MLXIPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Atg14 ZapB DUF3584 TolA_bind_tri NUDE_C bZIP_1
Motif
Other DBs
NCBI-GeneID: 51085
NCBI-ProteinID: NP_116569
OMIM: 605678
HGNC: 12744
Ensembl: ENSG00000009950
Vega: OTTHUMG00000129995
Pharos: Q9NP71(Tbio)
UniProt: Q9NP71
LinkDB All DBs
Position
7q11.23
AA seq 852 aa AA seqDB search
MAGALAGLAAGLQVPRVAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSD
SLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKI
RLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIEVVMRE
YHKWRIYYKKRLRKPSREDDLLAPKQAEGRWPPPEQWCKQLFSSVVPVLLGDPEEEPGGR
QLLDLNCFLSDISDTLFTMTQSGPSPLQLPPEDAYVGNADMIQPDLTPLQPSLDDFMDIS
DFFTNSRLPQPPMPSNFPEPPSFSPVVDSLFSSGTLGPEVPPASSAMTHLSGHSRLQARN
SCPGPLDSSAFLSSDFLLPEDPKPRLPPPPVPPPLLHYPPPAKVPGLEPCPPPPFPPMAP
PTALLQEEPLFSPRFPFPTVPPAPGVSPLPAPAAFPPTPQSVPSPAPTPFPIELLPLGYS
EPAFGPCFSMPRGKPPAPSPRGQKASPPTLAPATASPPTTAGSNNPCLTQLLTAAKPEQA
LEPPLVSSTLLRSPGSPQETVPEFPCTFLPPTPAPTPPRPPPGPATLAPSRPLLVPKAER
LSPPAPSGSERRLSGDLSSMPGPGTLSVRVSPPQPILSRGRPDSNKTENRRITHISAEQK
RRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYILMLQQERAGLQEEAQQLRDE
IEELNAAINLCQQQLPATGVPITHQRFDQMRDMFDDYVRTRTLHNWKFWVFSILIRPLFE
SFNGMVSTASVHTLRQTSLAWLDQYCSLPALRPTVLNSLRQLGTSTSILTDPGRIPEQAT
RAVTEGTLGKPL
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgcgctggcaggtctggccgcgggcttgcaggtcccgcgggtcgcgcccagc
ccagactcggactcggacacagactcggaggacccgagtctccggcgcagcgcgggcggc
ttgctccgctcgcaggtcatccacagcggtcacttcatggtgtcgtcgccgcacagcgac
tcgctgccccggcggcgcgaccaggaggggtccgtggggccctccgacttcgggccgcgc
agtatcgaccccacactcacacgcctcttcgagtgcttgagcctggcctacagtggcaag
ctggtgtctcccaagtggaagaatttcaaaggcctcaagctgctctgcagagacaagatc
cgcctgaacaacgccatctggagggcctggtatatccagtatgtgaagcggaggaagagc
cccgtgtgtggcttcgtgacccccctgcaggggcctgaggctgatgcgcaccggaagccg
gaggccgtggtcctggaggggaactactggaagcggcgcatcgaggtggtgatgcgggaa
taccacaagtggcgcatctactacaagaagcggctccgtaagcccagcagggaagatgac
ctcctggcccctaagcaggcggaaggcaggtggccgccgccggagcaatggtgcaaacag
ctcttctccagtgtggtccccgtgctgctgggggacccagaggaggagccgggtgggcgg
cagctcctggacctcaattgctttttgtccgacatctcagacactctcttcaccatgact
cagtccggcccttcgcccctgcagctgccgcctgaggatgcctacgtcggcaatgctgac
atgatccagccggacctgacgccactgcagccaagcctggatgacttcatggacatctca
gatttctttaccaactcccgcctcccacagccgcccatgccttcaaacttcccagagccc
cccagcttcagccccgtggttgactccctcttcagcagtgggaccctgggcccagaggtg
cccccggcttcctcggccatgacccacctctctggacacagccgtctgcaggctcggaac
agctgccctggccccttggactccagcgccttcctgagttctgatttcctccttcctgaa
gaccccaagccccggctcccaccccctcctgtacccccacctctgctgcattaccctccc
cctgccaaggtgccaggcctggagccctgccccccacctcccttccctcccatggcacca
cccactgctttgctgcaggaagagcctctcttctctcccaggtttcccttccccaccgtc
cctcctgccccaggagtgtctccgctgcctgctcctgcagccttcccacccaccccacag
tctgtccccagcccagcccccacccccttccccatagagcttctacccttggggtattcg
gagcctgcctttgggccttgcttctccatgcccagaggcaagccccccgccccatcccct
aggggacagaaagccagcccccctaccttagcccctgccactgccagtccccccaccact
gcggggagcaacaacccctgcctcacacagctgctcacagcagctaagccggagcaagcc
ctggagccaccacttgtatccagcaccctcctccggtccccagggtccccgcaggagaca
gtccctgaattcccctgcacattccttcccccgaccccggcccctacaccgccccggcca
cctccaggcccggccacattggccccttccaggcccctgcttgtccccaaagcggagcgg
ctctcacccccagcgcccagcggcagtgaacggcggctgtcaggggacctcagctccatg
ccaggccctgggactctgagcgtccgtgtctctcccccgcaacccatcctcagccggggc
cgtccagacagcaacaagaccgagaaccggcgtatcacacacatctccgcggagcagaag
cggcgcttcaacatcaagctggggtttgacacccttcatgggctcgtgagcacactcagt
gcccagcccagcctcaaggtgagcaaagctaccacgctgcagaagacagctgagtacatc
cttatgctacagcaggagcgtgcgggcttgcaggaggaggcccagcagctgcgggatgag
attgaggagctcaatgccgccattaacctgtgccagcagcagctgcccgccacaggggta
cccatcacacaccagcgttttgaccagatgcgagacatgtttgatgactacgtccgaacc
cgtacgctgcacaactggaagttctgggtgttcagcatcctcatccggcctctgtttgag
tccttcaacgggatggtgtccacggcaagtgtgcacaccctccgccagacctcactggcc
tggctggaccagtactgctctctgcccgctctccggccaactgtcctgaactccctacgc
cagctgggcacatctaccagtatcctgaccgacccgggccgcatccctgagcaagccaca
cgggcagtcacagagggcacccttggcaaacctttatag

DBGET integrated database retrieval system