KEGG   Homo sapiens (human): 51160
Entry
51160             CDS       T01001                                 
Symbol
VPS28
Name
(RefSeq) VPS28 subunit of ESCRT-I
  KO
K12184  ESCRT-I complex subunit VPS28
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    51160 (VPS28)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51160 (VPS28)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    51160 (VPS28)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    51160 (VPS28)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   51160 (VPS28)
  Exosomal proteins of other body fluids (saliva and urine)
   51160 (VPS28)
  Exosomal proteins of colorectal cancer cells
   51160 (VPS28)
  Exosomal proteins of bladder cancer cells
   51160 (VPS28)
SSDB
Motif
Pfam: VPS28 DAHL
Other DBs
NCBI-GeneID: 51160
NCBI-ProteinID: NP_057292
OMIM: 611952
HGNC: 18178
Ensembl: ENSG00000160948
Pharos: Q9UK41(Tbio)
UniProt: Q9UK41 Q548N1
Structure
LinkDB
Position
8:complement(144423617..144428548)
AA seq 221 aa
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VSPSEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtttcatgggatcccagccacgccgggcataggagcccctgggaacaagccggagctg
tatgaggaagtgaagttgtacaagaacgcccgggagagggagaagtacgacaacatggca
gagctgtttgcggtggtgaagacaatgcaagccctggagaaggcctacatcaaggactgt
gtctcccccagcgagtacactgcagcctgctcccggctcctggtccaatacaaagctgcc
ttcaggcaggtccagggctcagaaatcagctctattgacgaattctgccgcaagttccgc
ctggactgcccgctggccatggagcggatcaaggaggaccggcccatcaccatcaaggac
gacaagggcaacctcaaccgctgcatcgcagacgtggtctcgctcttcatcacggtcatg
gacaagctgcgtctggagatccgcgccatggatgagatccagcccgacctgcgagagctg
atggagaccatgcaccgcatgagccacctcccacccgactttgagggccgccagacggtc
agccagtggctgcagaccctgagcggcatgtcggcgtcagatgagctggacgactcacag
gtgcgtcagatgctgttcgacctggagtcagcctacaacgccttcaaccgcttcctgcat
gcctga

DBGET integrated database retrieval system