KEGG   Homo sapiens (human): 51164
Entry
51164             CDS       T01001                                 

Gene name
DCTN4, DYN4, P62
Definition
(RefSeq) dynactin subunit 4
  KO
K10426  dynactin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    51164 (DCTN4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    51164 (DCTN4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    51164 (DCTN4)
   05016 Huntington disease
    51164 (DCTN4)
   05022 Pathways of neurodegeneration - multiple diseases
    51164 (DCTN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    51164 (DCTN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    51164 (DCTN4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     51164 (DCTN4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     51164 (DCTN4)
SSDB
Motif
Pfam: Dynactin_p62
Other DBs
NCBI-GeneID: 51164
NCBI-ProteinID: NP_057305
OMIM: 614758
HGNC: 15518
Ensembl: ENSG00000132912
Vega: OTTHUMG00000130079
Pharos: Q9UJW0(Tbio)
UniProt: Q9UJW0 Q9NSJ5 A0A0S2Z5D4
LinkDB
Position
5q33.1
AA seq 460 aa
MASLLQSDRVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSD
KYGLGTRLQRPRAGASISTLAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYYTRPVNLT
EVTTLQQRLLQPDFQPVCASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQL
VAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLFECEEGDPDDINSTAKVVV
PPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFK
MKHDFKNLAAPIRPIEESDQGTEVIWLTQHVELSLGPLLP
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggcgtccttgctgcagtcggaccgggttctctatctagtccagggagaaaagaaggtt
cgggccccgctctcgcaactctacttctgccgctattgtagcgaactgcggtcgctggaa
tgtgtgtctcacgaggtggactcccattattgtcccagttgtttagaaaatatgccatcg
gctgaagccaaactaaaaaagaatagatgtgccaattgttttgactgtcctggctgcatg
cacaccctctctactcgggccacgagcatctccacacagcttccagatgacccagccaag
accaccatgaagaaagcctattacctggcatgtggattttgtcgctggacgtctagagat
gtgggcatggcagacaaatctgtagctagtggcggttggcaggaacctgaaaatcctcac
acacaacggatgaacaaattgattgaatattaccagcagcttgctcagaaagagaaggtt
gagcgagatcgcaagaaactggcacgacgtagaaactatatgcctctggctttttcggac
aaatatggtcttggaaccaggcttcagcgaccacgagctggtgcatccatcagtaccctt
gccggactttcccttaaagaaggagaggatcagaaagagataaagattgagccagctcag
gctgtggatgaagtggaacctctacctgaagactattatacaagaccagtaaatttaaca
gaggtaacaacccttcagcagcgtctgttacagcctgacttccagccagtctgtgcttca
cagctctatcctcgccacaaacatcttctgatcaaacggtccctgcgctgccgtaaatgt
gaacataatttgagcaagccagaatttaacccaacgtcaatcaaattcaaaatccagctg
gtcgctgtcaattatattccagaagtgagaatcatgtcaattcccaaccttcgctacatg
aaggagagccaggtcctcctgactcttacaaatccagttgagaacctcacccatgtgact
ctcttcgagtgtgaggagggggaccctgatgatatcaacagcactgctaaggtggtggtg
cctcccaaagagctcgttttagctggcaaggatgcagcagcagagtacgatgagttggca
gaacctcaagactttcaggacgatcctgacattatagccttcagaaaggccaacaaagtg
ggtattttcatcaaagttacaccacagcgtgaggagggtgaagtgaccgtgtgcttcaag
atgaagcatgattttaaaaacctggcagcccccattcgccccattgaagaaagtgaccag
ggaacagaagtcatctggctcacccagcatgtggaacttagcttgggcccacttcttcct
taa

DBGET integrated database retrieval system