KEGG   Homo sapiens (human): 51266
Entry
51266             CDS       T01001                                 
Symbol
CLEC1B, 1810061I13Rik, CLEC2, CLEC2B, PRO1384, QDED721
Name
(RefSeq) C-type lectin domain family 1 member B
  KO
K10070  C-type lectin domain family 1 member B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    51266 (CLEC1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    51266 (CLEC1B)
   04091 Lectins [BR:hsa04091]
    51266 (CLEC1B)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   51266 (CLEC1B)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   51266 (CLEC1B)
SSDB
Motif
Pfam: Lectin_C UL45 DUF4736 VirB8
Other DBs
NCBI-GeneID: 51266
NCBI-ProteinID: NP_057593
OMIM: 606783
HGNC: 24356
Ensembl: ENSG00000165682
Pharos: Q9P126(Tbio)
UniProt: Q9P126
Structure
LinkDB
Position
12:complement(9993075..10001899)
AA seq 229 aa
MQDEDGYITLNIKTRKPALISVGSASSSWWRVMALILLILCVGMVVGLVALGIWSVMQRN
YLQGENENRTGTLQQLAKRFCQYVVKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHN
LTWEESKQYCTDMNATLLKIDNRNIVEYIKARTHLIRWVGLSRQKSNEVWKWEDGSVISE
NMFEFLEDGKGNMNCAYFHNGKMHPTFCENKHYLMCERKAGMTKVDQLP
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcaggatgaagatggatacatcaccttaaatattaaaactcggaaaccagctctcatc
tccgttggctctgcatcctcctcctggtggcgtgtgatggctttgattctgctgatcctg
tgcgtggggatggttgtcgggctggtggctctggggatttggtctgtcatgcagcgcaat
tacctacaaggtgagaatgaaaatcgcacaggaactctgcaacaattagcaaagcgcttc
tgtcaatatgtggtaaaacaatcagaactaaagggcactttcaaaggtcataaatgcagc
ccctgtgacacaaactggagatattatggagatagctgctatgggttcttcaggcacaac
ttaacatgggaagagagtaagcagtactgcactgacatgaatgctactctcctgaagatt
gacaaccggaacattgtggagtacatcaaagccaggactcatttaattcgttgggtcgga
ttatctcgccagaagtcgaatgaggtctggaagtgggaggatggctcggttatctcagaa
aatatgtttgagtttttggaagatggaaaaggaaatatgaattgtgcttattttcataat
gggaaaatgcaccctaccttctgtgagaacaaacattatttaatgtgtgagaggaaggct
ggcatgaccaaggtggaccaactaccttaa

DBGET integrated database retrieval system