KEGG   Homo sapiens (human): 51324
Entry
51324             CDS       T01001                                 
Symbol
SPG21, ABHD21, ACP33, BM-019, GL010, MAST
Name
(RefSeq) SPG21 abhydrolase domain containing, maspardin
  KO
K19367  maspardin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    51324 (SPG21)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Thioesterase Abhydrolase_5
Other DBs
NCBI-GeneID: 51324
NCBI-ProteinID: NP_001121361
OMIM: 608181
HGNC: 20373
Ensembl: ENSG00000090487
Pharos: Q9NZD8(Tbio)
UniProt: Q9NZD8 A0A024R5Y1
LinkDB
Position
15:complement(64963022..64989914)
AA seq 308 aa
MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFF
RQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAE
YTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADA
IDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYK
LYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGS
LGISQEEQ
NT seq 927 nt   +upstreamnt  +downstreamnt
atgggagagattaaagtctctcctgattataactggtttagaggtacagttccccttaaa
aagattattgtggatgatgatgacagtaagatatggtcgctctatgacgcgggcccccga
agtatcaggtgtcctctcatattcctgccccctgtcagtggaactgcagatgtctttttc
cggcagattttggctctgactggatggggttaccgggttatcgctttgcagtatccagtt
tattgggaccatctcgagttctgtgatggattcagaaaacttttagaccatttacaattg
gataaagttcatctttttggcgcttctttgggaggctttttggcccagaaatttgctgaa
tacactcacaaatctcctagagtccattccctaatcctctgcaattccttcagtgacacc
tctatcttcaaccaaacttggactgcaaacagcttttggctgatgcctgcatttatgctc
aaaaaaatagttcttggaaatttttcatctggcccggtggaccctatgatggctgatgcc
attgatttcatggtagacaggctagaaagtttgggtcagagtgaactggcttcaagactt
accttgaattgtcaaaattcttatgtggaacctcataaaattcgggacatacctgtaact
attatggatgtgtttgatcagagtgcgctttcaactgaagctaaagaagaaatgtacaag
ctgtatcctaatgcccgaagagctcatctgaaaacaggaggcaatttcccatacctgtgc
agaagtgcagaggtcaatctttatgtacagatacatttgctgcaattccatggaaccaaa
tacgcggccattgacccatcaatggtcagtgccgaggagcttgaggtgcagaaaggcagc
cttggcatcagccaggaggagcagtag

DBGET integrated database retrieval system